Comparing SM_b21508 FitnessBrowser__Smeli:SM_b21508 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
34% identity, 88% coverage: 16:282/304 of query aligns to 11:273/291 of 4dxvA
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
34% identity, 88% coverage: 16:282/304 of query aligns to 11:273/291 of 3u8gA
Sites not aligning to the query:
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
34% identity, 88% coverage: 16:282/304 of query aligns to 11:273/291 of 3tdfA
Sites not aligning to the query:
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
34% identity, 88% coverage: 16:282/304 of query aligns to 11:273/291 of 3tceA
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
34% identity, 88% coverage: 16:282/304 of query aligns to 11:273/291 of 3rk8A
3pueB Crystal structure of the complex of dhydrodipicolinate synthase from acinetobacter baumannii with lysine at 2.6a resolution
34% identity, 88% coverage: 16:282/304 of query aligns to 11:273/291 of 3pueB
3na8A Crystal structure of a putative dihydrodipicolinate synthetase from pseudomonas aeruginosa
34% identity, 76% coverage: 7:238/304 of query aligns to 3:231/291 of 3na8A
4fhaA Structure of dihydrodipicolinate synthase from streptococcus pneumoniae,bound to pyruvate and lysine
32% identity, 93% coverage: 16:299/304 of query aligns to 16:292/307 of 4fhaA
Q07607 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; Protein MosA; EC 4.3.3.7 from Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
31% identity, 96% coverage: 6:296/304 of query aligns to 1:287/292 of Q07607
7kg2A Dihydrodipicolinate synthase (dhdps) from c.Jejuni, h59k mutant with pyruvate bound in the active site and l-histidine bound at the allosteric site
34% identity, 86% coverage: 21:282/304 of query aligns to 17:273/296 of 7kg2A
7kkdB Dihydrodipicolinate synthase (dhdps) from c.Jejuni, n84a mutant with pyruvate bound in the active site and r,r-bislysine bound at the allosteric site
33% identity, 86% coverage: 21:282/304 of query aligns to 27:283/306 of 7kkdB
4m19A Dihydrodipicolinate synthase from c. Jejuni with pyruvate bound to the active site and lysine bound to allosteric site (see paper)
34% identity, 86% coverage: 21:282/304 of query aligns to 17:273/296 of 4m19A
6u01B Dihydrodipicolinate synthase (dhdps) from c.Jejuni, n84d mutant with pyruvate bound in the active site (see paper)
34% identity, 86% coverage: 21:282/304 of query aligns to 17:273/296 of 6u01B
3s8hA Structure of dihydrodipicolinate synthase complexed with 3- hydroxypropanoic acid(hpa)at 2.70 a resolution
35% identity, 92% coverage: 16:296/304 of query aligns to 11:287/292 of 3s8hA
Sites not aligning to the query:
3puoA Crystal structure of dihydrodipicolinate synthase from pseudomonas aeruginosa(psdhdps)complexed with l-lysine at 2.65a resolution (see paper)
35% identity, 92% coverage: 16:296/304 of query aligns to 11:287/292 of 3puoA
2atsA Dihydrodipicolinate synthase co-crystallised with (s)-lysine
30% identity, 91% coverage: 6:283/304 of query aligns to 1:278/292 of 2atsA
P0A6L2 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Escherichia coli (strain K12) (see 7 papers)
30% identity, 91% coverage: 6:283/304 of query aligns to 1:278/292 of P0A6L2
5t25A Kinetic, spectral and structural characterization of the slow binding inhibitor acetopyruvate with dihydrodipicolinate synthase from escherichia coli.
30% identity, 91% coverage: 6:283/304 of query aligns to 2:279/293 of 5t25A
3i7sA Dihydrodipicolinate synthase mutant - k161a - with the substrate pyruvate bound in the active site. (see paper)
29% identity, 91% coverage: 6:283/304 of query aligns to 1:278/292 of 3i7sA
Q8UGL3 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
33% identity, 87% coverage: 6:269/304 of query aligns to 1:262/294 of Q8UGL3
>SM_b21508 FitnessBrowser__Smeli:SM_b21508
MAPAVLFEGLSAFPPTPADMDGKVSEDALSRLLERIRVARADSIGLLGSTGAYAFLSRGE
RRRAVETAVECVGGRVPLIVGVGALRTDEAQALARDAKEAGADGLLLAPVSYTPLTEEEV
YQHFVAVAGASDLPLCIYNNPGTTKFVFSEELIVRLSQVPNIAAVKMPLPADGDFEGEIA
RLRAKTSAAFAIGYSGDWGAADALLSGADAWFSVVGGLLPAPASKLARAAKAGDRAEAHR
IDMAFQPLWALFKEFGSFRVMYAIGSILGLFQALPPRPILPLGPGDSVRVKQAVQELIDI
QECS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory