Comparing SM_b21532 SM_b21532 phosphate acetyltransferase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
P38503 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.8 from Methanosarcina thermophila (see 2 papers)
42% identity, 99% coverage: 4:330/330 of query aligns to 5:329/333 of P38503
Sites not aligning to the query:
2af3C Phosphotransacetylase from methanosarcina thermophila soaked with coenzyme a (see paper)
42% identity, 99% coverage: 4:330/330 of query aligns to 4:328/332 of 2af3C
6ioxA Crystal structure of porphyromonas gingivalis phosphotransacetylase in complex with acetyl-coa (see paper)
43% identity, 98% coverage: 5:329/330 of query aligns to 6:334/339 of 6ioxA
1xcoD Crystal structure of a phosphotransacetylase from bacillus subtilis in complex with acetylphosphate (see paper)
44% identity, 95% coverage: 17:329/330 of query aligns to 20:324/325 of 1xcoD
Q8ZND6 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.222; EC 2.3.1.8 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
42% identity, 98% coverage: 6:330/330 of query aligns to 394:710/714 of Q8ZND6
Sites not aligning to the query:
6zngF Maeb full-length acetyl-coa bound state (see paper)
35% identity, 95% coverage: 15:329/330 of query aligns to 438:743/753 of 6zngF
Sites not aligning to the query:
P76558 NADP-dependent malic enzyme; NADP-ME; EC 1.1.1.40 from Escherichia coli (strain K12) (see paper)
33% identity, 100% coverage: 1:329/330 of query aligns to 431:754/759 of P76558
Sites not aligning to the query:
>SM_b21532 SM_b21532 phosphate acetyltransferase
MKPLDRIIDAARKAPRHVVLPEGEDPRIVAGAVQARREGLAAITLVGNREVITQRLAALD
AIPQEFRIEDPACSPLTDDFATAYLERRRSKGVDAAAARAAVLSPLTFAAMMVREGIADG
TVGGAVATTADTVRAALQVIGRAPGVGLVSSFFLMMLCEPHHARKGAFVFADCGLVVDPD
AAGLADIARMSAKSYEMLAGERAKVAMLSFSTGGSAAHERVSKVVEATGMARRAEPDLII
DGELQFDSAFVEAVCLTKAPHSALRGEANVFVFPNLDAANIGYKIAQRIGGATAIGPILQ
GLSRPANDLSRGCTAADVFHMIAVTVVQAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory