Comparing SM_b21588 FitnessBrowser__Smeli:SM_b21588 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
40% identity, 97% coverage: 8:495/505 of query aligns to 4:490/501 of P04983
3c4jA Abc protein artp in complex with atp-gamma-s
29% identity, 45% coverage: 7:234/505 of query aligns to 2:228/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
29% identity, 45% coverage: 7:234/505 of query aligns to 2:228/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
29% identity, 45% coverage: 7:234/505 of query aligns to 2:228/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
29% identity, 45% coverage: 7:234/505 of query aligns to 2:228/242 of 2oljA
5x40A Structure of a cbio dimer bound with amppcp (see paper)
36% identity, 43% coverage: 8:223/505 of query aligns to 4:219/280 of 5x40A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
28% identity, 42% coverage: 14:223/505 of query aligns to 7:215/240 of 4ymuJ
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 48% coverage: 22:261/505 of query aligns to 19:261/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
30% identity, 48% coverage: 22:261/505 of query aligns to 20:262/344 of 6cvlD
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
30% identity, 48% coverage: 22:261/505 of query aligns to 20:262/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
30% identity, 48% coverage: 22:261/505 of query aligns to 20:262/344 of 3tuiC
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
30% identity, 43% coverage: 8:223/505 of query aligns to 2:215/241 of 4u00A
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
30% identity, 50% coverage: 5:258/505 of query aligns to 8:262/265 of P07821
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
28% identity, 48% coverage: 6:245/505 of query aligns to 2:231/285 of 4yerA
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
31% identity, 42% coverage: 23:236/505 of query aligns to 22:229/615 of 5lilA
Sites not aligning to the query:
3d31A Modbc from methanosarcina acetivorans (see paper)
32% identity, 43% coverage: 8:223/505 of query aligns to 4:207/348 of 3d31A
Sites not aligning to the query:
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
31% identity, 42% coverage: 23:236/505 of query aligns to 22:229/592 of 5lj7A
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 41% coverage: 14:222/505 of query aligns to 23:226/378 of P69874
Sites not aligning to the query:
Q9BZC7 ATP-binding cassette sub-family A member 2; ATP-binding cassette transporter 2; ATP-binding cassette 2; EC 7.6.2.- from Homo sapiens (Human) (see paper)
31% identity, 42% coverage: 263:473/505 of query aligns to 2059:2258/2435 of Q9BZC7
Sites not aligning to the query:
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
29% identity, 43% coverage: 8:223/505 of query aligns to 4:229/254 of 1g6hA
>SM_b21588 FitnessBrowser__Smeli:SM_b21588
MQTSSDNILSATRIEKGFPGTKALDRVDFHLRRGEVHALLGENGAGKSTLIKCLTGAYRR
DGGSMLLDGAEADPRDTFDAQRLGIGTVYQEVNLLPNLTVAENLFLGRQPRRFGMVDTRT
MNRKARELLAEYELDIDVTRDLASYSVAIQQVVAIARAVDLSGKVLILDEPTASLDAHEV
EMLFRIVRRLKERGLGIIFITHFLEQVYAISDRITVLRNGQLVGTRNAADLDRRELIAMM
IGRELATEIHSAHSDAVAGEPRYRFRNFGRRGKIDPFDLDVRAGEVVGMAGLLGSGRTET
AEILFGAHRADSGTAEIDGRSVDLSSPRAAIRQKFGFCPEDRKTAGIVGDLSVRENIVLA
LQARRGWTRPIPRAEQNRLADHYIRALDIRTADREKPIRLLSGGNQQKAILARWLATEPE
LLILDEPTRGIDVGAHAEIIRLIESLREKGMSLIVISSEIEELVAYSTRVVVLRDHAHVA
ELDGAQLTAHRIVEAIAATNGREAP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory