Comparing SM_b21603 SM_b21603 sugar uptake ABC transporter permease to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
P94529 Arabinooligosaccharides transport system permease protein AraP from Bacillus subtilis (strain 168) (see paper)
29% identity, 90% coverage: 7:268/291 of query aligns to 27:288/313 of P94529
P02916 Maltose/maltodextrin transport system permease protein MalF from Escherichia coli (strain K12) (see 4 papers)
30% identity, 74% coverage: 75:289/291 of query aligns to 287:512/514 of P02916
7cagA Mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state (see paper)
28% identity, 99% coverage: 3:290/291 of query aligns to 1:280/285 of 7cagA
4ki0F Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
30% identity, 71% coverage: 75:282/291 of query aligns to 272:490/490 of 4ki0F
P94530 Arabinooligosaccharides transport system permease protein AraQ from Bacillus subtilis (strain 168) (see paper)
26% identity, 60% coverage: 47:221/291 of query aligns to 54:207/281 of P94530
>SM_b21603 SM_b21603 sugar uptake ABC transporter permease
MTSERRSKTLTAVLMITPFVITYLTVFAYPVYKMFALSFTNAPLVGEGEWVGFDNYLKLL
NQKLFFTSVWNTGYFVVLTVIPNTLIGLGLALMVVRLKGWLQSLILVLFFLPYILPVSVV
TQIWEWVLDQQFGIAQHVIEFVTGRRISVFRDPLWAMPMVALVTIWWTNGFNLLLFIAGL
RNIPTDYYEAAMLDGATRWQCFKRITWPLIWPVTALVLTLQLILQLKIFDQVYLMTEGGP
FNSTYVLLQLVYREAFRLNHGGLGSAVAVFLFLIIVTVSVLQYQLLRVRGR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory