SitesBLAST
Comparing SM_b21632 SM_b21632 3-hydroxyacyl-CoA dehydrogenase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6iunB Crystal structure of enoyl-coa hydratase (ech) from ralstonia eutropha h16 in complex with NAD
43% identity, 89% coverage: 20:409/438 of query aligns to 266:659/692 of 6iunB
- active site: S407 (= S160), H428 (= H181), E440 (= E193), N478 (= N231)
- binding nicotinamide-adenine-dinucleotide: G300 (= G53), T301 (= T54), M302 (= M55), E321 (= E74), T322 (≠ R75), Y365 (= Y118), A377 (= A130), V378 (= V131), E380 (= E133), V384 (= V137), V388 (= V141), N405 (= N158), S407 (= S160)
Sites not aligning to the query:
Q08426 Peroxisomal bifunctional enzyme; PBE; PBFE; L-bifunctional protein; LBP; Multifunctional enzyme 1; MFE1; EC 4.2.1.17; EC 5.3.3.8; EC 1.1.1.35 from Homo sapiens (Human) (see 5 papers)
35% identity, 95% coverage: 20:436/438 of query aligns to 268:706/723 of Q08426
- A274 (= A26) to T: in dbSNP:rs2302819
- A325 (≠ L72) to G: in dbSNP:rs1062555
- K346 (≠ G93) modified: N6-acetyllysine; mutation to Q: Greatly reduced acetylation and insensitive to treatment with TSA and NAM; when associated with Q-165; Q-171 and Q-584.
- K584 (≠ A319) modified: N6-acetyllysine; alternate; mutation to Q: Greatly reduced acetylation and insensitive to treatment with TSA and NAM; when associated with Q-165; Q-171 and Q-346.
- K598 (≠ R333) to T: in dbSNP:rs1042437
- T606 (≠ A339) to P: in dbSNP:rs1042438
Sites not aligning to the query:
- 3 E → K: in FRTS3; the mutant is mistargeted to mitochondria; results in impaired mitochondrial oxidative phosphorylation and defects in the transport of fluids across the epithelium of renal proximal tubular cells; dbSNP:rs398124646
- 40 V → G: in dbSNP:rs1062551
- 41 I → R: in dbSNP:rs1062552
- 75 T → I: in dbSNP:rs1062553
- 165 modified: N6-acetyllysine; alternate; K→Q: Greatly reduced acetylation and insensitive to treatment with TSA and NAM; when associated with Q-171; Q-346 and Q-584.
- 171 modified: N6-acetyllysine; K→Q: Greatly reduced acetylation and insensitive to treatment with TSA and NAM; when associated with Q-165; Q-346 and Q-584.
3zw9A Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with (2s,3s)-3-hydroxy-2- methylbutanoyl-coa (see paper)
35% identity, 95% coverage: 20:436/438 of query aligns to 270:708/723 of 3zw9A
- active site: S413 (= S160), H434 (= H181), E446 (= E193), N484 (= N231)
- binding nicotinamide-adenine-dinucleotide: L305 (≠ I50), G306 (= G51), G308 (= G53), T309 (= T54), M310 (= M55), E329 (= E74), Q334 (≠ A79), A383 (= A130), V384 (= V131), F385 (= F132), E386 (= E133), N411 (= N158), S413 (= S160), H434 (= H181)
Sites not aligning to the query:
- active site: 64, 69, 79, 103, 106, 125, 126, 133, 134, 252
- binding (2s,3s)-3-hydroxy-2-methylbutanoyl-coa: 24, 62, 63, 64, 66, 102, 103, 106, 126, 133, 159
3zwaA Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 3s-hydroxy-hexanoyl-coa (see paper)
35% identity, 95% coverage: 20:436/438 of query aligns to 273:711/727 of 3zwaA
Sites not aligning to the query:
- active site: 67, 72, 82, 106, 109, 128, 129, 136, 137, 255
- binding (S)-3-Hydroxyhexanoyl-CoA: 27, 65, 66, 67, 68, 69, 104, 109, 124, 129, 132, 137, 162
3zwbA Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 2trans-hexenoyl-coa (see paper)
35% identity, 95% coverage: 20:436/438 of query aligns to 272:710/725 of 3zwbA
Sites not aligning to the query:
- active site: 66, 81, 105, 108, 127, 128, 135, 136
- binding (2E)-Hexenoyl-CoA: 25, 26, 28, 64, 65, 66, 67, 68, 101, 103, 105, 108, 136, 161
5omoA Crystal structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with with 3s-hydroxy-decanoyl-coa and 3-keto- decanoyl-coa
35% identity, 95% coverage: 20:436/438 of query aligns to 272:710/725 of 5omoA
Sites not aligning to the query:
- active site: 66, 71, 81, 105, 108, 127, 128, 135, 136, 254
- binding (s)-3-hydroxydecanoyl-coa: 25, 26, 28, 31, 64, 66, 67, 68, 103, 105, 108, 127, 128, 161, 260
5mgbA Crystal structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with acetoacetyl-coa and NAD (see paper)
35% identity, 95% coverage: 20:436/438 of query aligns to 272:710/725 of 5mgbA
- active site: S415 (= S160), H436 (= H181), E448 (= E193), N486 (= N231)
- binding nicotinamide-adenine-dinucleotide: L307 (≠ I50), G308 (= G51), G310 (= G53), T311 (= T54), M312 (= M55), E331 (= E74), S332 (≠ R75), Q336 (≠ A79), V386 (= V131), F387 (= F132), E388 (= E133), N413 (= N158), S415 (= S160), H436 (= H181)
Sites not aligning to the query:
- active site: 66, 71, 81, 105, 108, 127, 128, 135, 136, 254
- binding acetoacetyl-coenzyme a: 25, 26, 64, 65, 66, 67, 68, 105, 128, 161
3zwcA Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 3s-hydroxy-decanoyl-coa (see paper)
35% identity, 95% coverage: 20:436/438 of query aligns to 272:710/725 of 3zwcA
- active site: S415 (= S160), H436 (= H181), E448 (= E193), N486 (= N231)
- binding nicotinamide-adenine-dinucleotide: G308 (= G51), G310 (= G53), T311 (= T54), M312 (= M55), E331 (= E74), Q336 (≠ A79), A385 (= A130), V386 (= V131), F387 (= F132), E388 (= E133), K393 (= K138), N413 (= N158), S415 (= S160), H436 (= H181)
Sites not aligning to the query:
- active site: 66, 71, 81, 105, 108, 127, 128, 135, 136, 254
- binding (s)-3-hydroxydecanoyl-coa: 26, 64, 65, 66, 67, 68, 77, 78, 80, 101, 104, 105, 108, 128, 260
2x58A The crystal structure of mfe1 liganded with coa (see paper)
35% identity, 95% coverage: 20:436/438 of query aligns to 272:710/725 of 2x58A
- active site: S415 (= S160), H436 (= H181), E448 (= E193), N486 (= N231)
- binding adenosine-5'-diphosphate: G310 (= G53), T311 (= T54), M312 (= M55), E331 (= E74), S332 (≠ R75), Q336 (≠ A79), V386 (= V131), L392 (≠ V137)
Sites not aligning to the query:
- active site: 66, 71, 81, 105, 108, 127, 128, 135, 136, 254
- binding coenzyme a: 26, 28, 64, 66, 67, 68, 128
6zibAAA structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with acetoacetyl-coa and nadh'
35% identity, 95% coverage: 20:436/438 of query aligns to 272:708/723 of 6zibAAA
- active site: S413 (= S160), H434 (= H181), E446 (= E193), N484 (= N231)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G310 (= G53), T311 (= T54), M312 (= M55), E331 (= E74), S332 (≠ R75), Q336 (≠ A79), A383 (= A130), V384 (= V131), F385 (= F132), E386 (= E133), N411 (= N158), H434 (= H181)
Sites not aligning to the query:
- active site: 66, 71, 81, 105, 108, 127, 128, 136, 254
- binding acetoacetyl-coenzyme a: 25, 26, 64, 65, 66, 67, 68, 104, 105, 128, 161
6zicAAA structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with 3s-hydroxybutanoyl-coa and nadh'
35% identity, 95% coverage: 20:436/438 of query aligns to 272:708/723 of 6zicAAA
- active site: S413 (= S160), H434 (= H181), E446 (= E193), N484 (= N231)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G308 (= G51), G310 (= G53), T311 (= T54), M312 (= M55), E331 (= E74), S332 (≠ R75), Q336 (≠ A79), A383 (= A130), V384 (= V131), F385 (= F132), E386 (= E133), L390 (≠ V137), K391 (= K138), N411 (= N158), S413 (= S160), H434 (= H181)
Sites not aligning to the query:
- active site: 66, 71, 81, 105, 108, 127, 128, 136, 254
- binding 3-hydroxybutanoyl-coenzyme a: 25, 26, 28, 66, 67, 68, 104, 105, 108, 128, 161
6z5oAAA Peroxisomal bifunctional enzyme (see paper)
35% identity, 95% coverage: 20:436/438 of query aligns to 273:704/716 of 6z5oAAA
- active site: S409 (= S160), H430 (= H181), E442 (= E193), N480 (= N231)
- binding coenzyme a: F277 (= F24), K281 (≠ R28)
- binding nicotinamide-adenine-dinucleotide: G309 (= G51), G311 (= G53), T312 (= T54), M313 (= M55), E332 (= E74), S333 (≠ R75), Q337 (≠ A79), A379 (= A130), V380 (= V131), F381 (= F132), E382 (= E133), K387 (= K138), N407 (= N158), S409 (= S160), H430 (= H181)
Sites not aligning to the query:
- active site: 67, 72, 82, 106, 109, 128, 129, 137, 255
- binding coenzyme a: 26, 27, 65, 68, 69, 128, 162
- binding nicotinamide: 67, 109, 129, 136, 261
3k6jA Crystal structure of the dehydrogenase part of multifuctional enzyme 1 from c.Elegans
30% identity, 85% coverage: 40:412/438 of query aligns to 42:407/430 of 3k6jA
Sites not aligning to the query:
1wdlA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form ii (native4) (see paper)
29% identity, 97% coverage: 11:436/438 of query aligns to 281:711/715 of 1wdlA
- active site: S430 (= S160), H451 (= H181), E463 (= E193), N501 (= N231)
- binding nicotinamide-adenine-dinucleotide: A322 (≠ G52), I324 (≠ T54), M325 (= M55), D344 (≠ E74), I345 (≠ R75), A400 (= A130), V401 (= V131), E403 (= E133), N428 (= N158), T429 (= T159), S430 (= S160)
Sites not aligning to the query:
P28793 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Pseudomonas fragi (see paper)
29% identity, 97% coverage: 11:436/438 of query aligns to 281:711/715 of P28793
- D297 (≠ E27) binding
- M325 (= M55) binding
- D344 (≠ E74) binding
- VVE 401:403 (≠ VFE 131:133) binding
- K408 (= K138) binding
- S430 (= S160) binding
- N454 (≠ S184) binding
- N501 (= N231) binding
- Y660 (≠ H385) binding
6yswA E. Coli anaerobic trifunctional enzyme subunit-alpha in complex with coenzyme a
31% identity, 98% coverage: 9:436/438 of query aligns to 271:700/707 of 6yswA
Sites not aligning to the query:
- active site: 66, 71, 84, 88, 112, 115, 136, 137, 145, 264
- binding coenzyme a: 23, 25, 66, 67, 68, 136, 137, 140
1wdmA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form i (native3) (see paper)
28% identity, 97% coverage: 11:436/438 of query aligns to 281:703/707 of 1wdmA
- active site: S430 (= S160), H451 (= H181), E463 (= E193), N501 (= N231)
- binding acetyl coenzyme *a: D297 (≠ E27), M459 (= M189), N501 (= N231), P534 (= P264), Y652 (≠ H385), L658 (≠ R391)
- binding nicotinamide-adenine-dinucleotide: G321 (= G51), A322 (≠ G52), I324 (≠ T54), M325 (= M55), D344 (≠ E74), V401 (= V131), E403 (= E133), N428 (= N158), S430 (= S160), N454 (≠ S184)
Sites not aligning to the query:
P21177 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Escherichia coli (strain K12) (see 2 papers)
30% identity, 75% coverage: 67:395/438 of query aligns to 336:670/729 of P21177
- H450 (= H181) active site, For 3-hydroxyacyl-CoA dehydrogenase activity; mutation H->A,Q: Almost complete loss of 3-hydroxyacyl-CoA dehydrogenase activity.
Sites not aligning to the query:
- 116 G→F: Absence of both enoyl-CoA hydratase and 3-hydroxyacyl-CoA epimerase activities. Delta(3)-cis-Delta(2)-trans-enoyl-CoA isomerase is only slightly affected.
- 322 G→A: 10-fold increase in KM for NADH.
6tnmA E. Coli aerobic trifunctional enzyme subunit-alpha (see paper)
30% identity, 75% coverage: 67:395/438 of query aligns to 336:670/719 of 6tnmA
Sites not aligning to the query:
P40939 Trifunctional enzyme subunit alpha, mitochondrial; 78 kDa gastrin-binding protein; Monolysocardiolipin acyltransferase; TP-alpha; EC 2.3.1.-; EC 4.2.1.17; EC 1.1.1.211 from Homo sapiens (Human) (see 5 papers)
27% identity, 96% coverage: 9:428/438 of query aligns to 328:750/763 of P40939
- L342 (≠ V23) to P: in LCHAD deficiency; dbSNP:rs137852772
- E510 (= E193) active site, For hydroxyacyl-coenzyme A dehydrogenase activity; to Q: in AFLP and LCHAD deficiency; loss of long-chain-3-hydroxyacyl-CoA dehydrogenase activity; dbSNP:rs137852769
Sites not aligning to the query:
- 282 V → D: in MTPD1; mild phenotype with slowly progressive myopathy and sensorimotor polyneuropathy; dbSNP:rs137852773
- 305 I → N: in MTPD1; mild phenotype with slowly progressive myopathy and sensorimotor polyneuropathy; dbSNP:rs137852774
Query Sequence
>SM_b21632 SM_b21632 3-hydroxyacyl-CoA dehydrogenase
MPLSIVHSGGIAVVATGNPLRYVFHAERAARHPPALAGIEPRPIRSAAVIGGGTMGTGIA
AALLHAGLPLVLVERDEAAVERALARLRTIFDGAVKRGRISAGLAAERLAGVTGSTDYTA
IAEADLIIEAVFEDLDVKRDVFRRLAAVCRADAILATNTSYLDPERIAADIGSRERFLGL
HFFSPAQVMKLLEIVPTQATAPDVLATGFALARMLNKIPVRAGISDGFIGNRILKVTRAQ
AERLLLSGATPAAVDAAMRAFGLPMGPFEAQDLGGLDIAAFQRRAARARGETTFAPVADR
LSAIERFGQKSGGGWYDYAPGDRTPRPSATVARIIAEEARGWPRRDWDEASIVGCILWPM
VNEAARILEDGTALRASDIDLVEIHGYGFPRWRGGLMHHAEAHGLHKVAGALSGLAEAGL
ADPPCDPLLRAASRGSFL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory