Comparing SM_b21636 FitnessBrowser__Smeli:SM_b21636 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6khi1 Supercomplex for cylic electron transport in cyanobacteria (see paper)
41% identity, 23% coverage: 275:355/358 of query aligns to 12:91/98 of 6khi1
7fixR1 Photosystem I reaction center subunit PsaK (see paper)
41% identity, 23% coverage: 275:355/358 of query aligns to 11:90/97 of 7fixR1
6yacN Plant psi-ferredoxin supercomplex (see paper)
41% identity, 24% coverage: 272:358/358 of query aligns to 8:92/97 of 6yacN
7s3dX Structure of photosystem i with bound ferredoxin from synechococcus sp. Pcc 7335 acclimated to far-red light (see paper)
43% identity, 19% coverage: 290:358/358 of query aligns to 25:93/97 of 7s3dX
P0A3C7 Ferredoxin-1; Ferredoxin I from Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) (see paper)
42% identity, 19% coverage: 290:358/358 of query aligns to 27:95/99 of P0A3C7
1ewyC Anabaena pcc7119 ferredoxin:ferredoxin-NADP+-reductase complex (see paper)
42% identity, 19% coverage: 290:358/358 of query aligns to 26:94/98 of 1ewyC
1czpA Anabaena pcc7119 [2fe-2s] ferredoxin in the reduced and oxixized state at 1.17 a (see paper)
42% identity, 19% coverage: 290:358/358 of query aligns to 26:94/98 of 1czpA
7ylrA Structure of a bacteria protein
29% identity, 77% coverage: 81:354/358 of query aligns to 90:325/326 of 7ylrA
Sites not aligning to the query:
1frrA Crystal structure of [2fe-2s] ferredoxin i from equisetum arvense at 1.8 angstroms resolution (see paper)
42% identity, 20% coverage: 286:358/358 of query aligns to 19:91/95 of 1frrA
1rfkB Crystal structure of 2fe2s ferredoxin from thermophilic cyanobacterium mastigocladus laminosus (see paper)
36% identity, 23% coverage: 275:358/358 of query aligns to 12:94/97 of 1rfkB
P27787 Ferredoxin-1, chloroplastic; Ferredoxin I; Fd I from Zea mays (Maize) (see 2 papers)
39% identity, 19% coverage: 290:358/358 of query aligns to 76:144/150 of P27787
Sites not aligning to the query:
3b2gA Leptolyngbya boryana ferredoxin (see paper)
39% identity, 19% coverage: 290:358/358 of query aligns to 26:94/98 of 3b2gA
1pfdA The solution structure of high plant parsley [2fe-2s] ferredoxin, nmr, 18 structures (see paper)
39% identity, 19% coverage: 290:358/358 of query aligns to 24:92/96 of 1pfdA
1gaqB Crystal structure of the complex between ferredoxin and ferredoxin- NADP+ reductase (see paper)
39% identity, 19% coverage: 290:358/358 of query aligns to 24:92/98 of 1gaqB
2piaA Phthalate dioxygenase reductase: a modular structure for electron transfer from pyridine nucleotides to [2fe-2s] (see paper)
25% identity, 84% coverage: 54:354/358 of query aligns to 54:319/321 of 2piaA
Sites not aligning to the query:
P33164 Phthalate dioxygenase reductase; PDR; EC 1.-.-.- from Burkholderia cepacia (Pseudomonas cepacia) (see paper)
25% identity, 84% coverage: 54:354/358 of query aligns to 55:320/322 of P33164
1awdA Ferredoxin [2fe-2s] oxidized form from chlorella fusca (see paper)
41% identity, 20% coverage: 286:358/358 of query aligns to 18:90/94 of 1awdA
P56408 Ferredoxin from Scenedesmus fuscus (Green alga) (Chlorella fusca) (see paper)
41% identity, 20% coverage: 286:358/358 of query aligns to 18:90/94 of P56408
Sites not aligning to the query:
4itkA The structure of c.Reinhardtii ferredoxin 2 (see paper)
46% identity, 19% coverage: 290:358/358 of query aligns to 23:90/104 of 4itkA
O80429 Ferredoxin-2, chloroplastic; Ferredoxin II; Fd II from Zea mays (Maize) (see 2 papers)
42% identity, 19% coverage: 290:358/358 of query aligns to 68:136/140 of O80429
Sites not aligning to the query:
>SM_b21636 FitnessBrowser__Smeli:SM_b21636
MARFYPLQVTEVRRDTRDAVVVTLEPREEDRAAFDFTQGQYLTFRRLFGGEELRRSYSIC
AGLDEGALKVGIKRVDDGCFSSWANEELEPGDTLEAMPPMGAFFTPIEPEAAKHYLGFAG
GSGITPVLSLVKTVLAREPRSAFTLVYANRHFSSIMFREELDDLKNLYLGRLSVLHVLES
EAQEIDLFSGRLDREKCTALFRSWIDVRSADTAFICGPEPMMLGVAAALRAHGLGDDRIK
FELFAASQPGRARRKVESAAGADSRARCEATVTLDGATRSFTFPKEGLSLLEAALENRMD
APFACKAGVCSSCRAKVLEGEVEMESNNALEDYEVEQGYVLTCQSYPLSDRIVVSYDQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory