Comparing SM_b21655 FitnessBrowser__Smeli:SM_b21655 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5ldrA Crystal structure of a cold-adapted dimeric beta-d-galactosidase from paracoccus sp. 32d strain in complex with galactose (see paper)
62% identity, 97% coverage: 2:732/755 of query aligns to 1:715/731 of 5ldrA
5t99A Crystal structure of bugh2awt in complex with galactoisofagomine (see paper)
28% identity, 100% coverage: 2:755/755 of query aligns to 1:749/757 of 5t99A
7cwdA Crystal structure of beta-galactosidase ii from bacillus circulans in complex with beta-d-galactopyranosyl disaccharide (see paper)
26% identity, 93% coverage: 2:705/755 of query aligns to 1:746/803 of 7cwdA
6d50B Bacteroides uniforms beta-glucuronidase 2 bound to d-glucaro-1,5- lactone (see paper)
27% identity, 77% coverage: 3:584/755 of query aligns to 2:624/840 of 6d50B
6nzgA Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine (see paper)
27% identity, 77% coverage: 3:584/755 of query aligns to 2:624/837 of 6nzgA
6qudA 2-deoxy-galactose reaction intermediate of a truncated beta- galactosidase iii from bifidobacterium bifidum
24% identity, 99% coverage: 5:755/755 of query aligns to 9:827/837 of 6qudA
5dmyA Beta-galactosidase - construct 33-930
24% identity, 99% coverage: 5:755/755 of query aligns to 11:845/855 of 5dmyA
8dhlB Tannerella forsythia beta-glucuronidase (l2) (see paper)
27% identity, 71% coverage: 3:541/755 of query aligns to 2:575/853 of 8dhlB
Sites not aligning to the query:
8dhlA Tannerella forsythia beta-glucuronidase (l2) (see paper)
27% identity, 71% coverage: 3:541/755 of query aligns to 3:561/827 of 8dhlA
Sites not aligning to the query:
6ncxB Crystal structure of gh2 beta-galacturonidase from eisenbergiella tayi bound to galacturonate (see paper)
29% identity, 66% coverage: 44:541/755 of query aligns to 45:547/559 of 6ncxB
6mvgA Crystal structure of fmn-binding beta-glucuronidase from ruminococcus gnavus (see paper)
26% identity, 80% coverage: 3:605/755 of query aligns to 1:608/637 of 6mvgA
6mvfA Crystal structure of fmn-binding beta-glucuronidase from facaelibacterium prausnitzii l2-6 (see paper)
27% identity, 68% coverage: 2:511/755 of query aligns to 3:517/643 of 6mvfA
7kgzB Fmn-binding beta-glucuronidase from roseburia hominis (see paper)
30% identity, 57% coverage: 2:429/755 of query aligns to 1:425/634 of 7kgzB
Sites not aligning to the query:
5z1aA The crystal structure of bacteroides fragilis beta-glucuronidase in complex with uronic isofagomine
29% identity, 55% coverage: 2:415/755 of query aligns to 2:438/655 of 5z1aA
Sites not aligning to the query:
6d7jA The crystal structure of parabacteroides merdae beta-glucuronidase (gus) with glycerol in active-site (see paper)
26% identity, 76% coverage: 30:604/755 of query aligns to 45:657/799 of 6d7jA
6s6zA Structure of beta-galactosidase from thermotoga maritima (see paper)
32% identity, 44% coverage: 56:389/755 of query aligns to 112:447/1083 of 6s6zA
Sites not aligning to the query:
6cxsB Crystal structure of clostridium perfringens beta-glucuronidase bound with a novel, potent inhibitor 4-(8-(piperazin-1-yl)-1,2,3,4- tetrahydro-[1,2,3]triazino[4',5':4,5]thieno[2,3-c]isoquinolin-5-yl) morpholine (see paper)
26% identity, 65% coverage: 51:540/755 of query aligns to 71:583/599 of 6cxsB
6lddA Structure of bifidobacterium dentium beta-glucuronidase complexed with c6-propyl uronic isofagomine (see paper)
26% identity, 71% coverage: 3:540/755 of query aligns to 12:605/620 of 6lddA
6ldbA Structure of bifidobacterium dentium beta-glucuronidase complexed with uronic isofagomine (see paper)
26% identity, 71% coverage: 3:540/755 of query aligns to 12:605/620 of 6ldbA
6ld0A Structure of bifidobacterium dentium beta-glucuronidase complexed with c6-hexyl uronic isofagomine (see paper)
26% identity, 71% coverage: 3:540/755 of query aligns to 12:605/620 of 6ld0A
>SM_b21655 FitnessBrowser__Smeli:SM_b21655
MMRSVTSFNDSWVFSEGFDAADAGTLRAGQPISLPHNAVELPFNYFDERCYQRAFTYQRV
LAWRPDFSGREVSLVFDAAMADAVVYLNGEEIVAHRDGYTPFEARLTDRLLEGDNLITVK
IDGSENPEIPPFGGRIDYLTYAGIYRDVWLKVTDPVSIANIKIETRDVLSDTKAVSLRCD
LSNPQGLSFSGTISALLKNAAGEVLAEVAGETTGQSLAFEMDGLKGLSLWDIDDPVLYVI
EVELRTGQGSDCFAAHFGFRTAEFTTEGFRLNGRPLKIRGLNRHQSFPYVGYAMGRTAQE
RDADIMKHRLHCNLVRTSHYPQSKWFLDHCDRIGLLVFEEIPGWQHIGGEEWKQEAIRNV
RRMIERDWNHPSIVIWGVRINESQDSHDFYAETNRLARELDPTRQTGGVRYITDSEFLED
VYTMNDFILGNEELPGANRPRTALRPQQECTGLPRKVPYLITEFGGHMYPTKIYDQEQRQ
AEHVRRHLEVLNAAYGDPGISGAIGWCMFDYNTHKDFGSGDRICYHGVMDMFREPKFAAY
VYASQCDPSEEIVMKPVTFWARGERNIGGVLPLIVLTNCDEIELKYGSLTKRVGPDRENF
PHLPHPPVVIDHRHFTKDELGVWGMKWESAEFTGFIAGKPVADLRMAADPVPTTLQVEAD
SKTLRAEGRDSVRLILRALDQAGNVQPFLNDAVDIEIHGPARLVGPARIVLQGGSAGFWL
ESTGAAGAIVVSVASSRLGAAKLDLVALADGAASA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory