Comparing SMa0058 FitnessBrowser__Smeli:SMa0058 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
P32140 Sulfoquinovose isomerase; SQ isomerase; Sulfoquinovose-sulfofructose isomerase; SQ-SF isomerase; EC 5.3.1.31 from Escherichia coli (strain K12) (see paper)
32% identity, 88% coverage: 42:393/398 of query aligns to 38:393/413 of P32140
2zblA Functional annotation of salmonella enterica yihs-encoded protein (see paper)
32% identity, 88% coverage: 42:393/398 of query aligns to 38:393/416 of 2zblA
7ag4D Crystal structure of active site mutant of sq isomerase (yihs-h248a) from salmonella enterica in complex with sulfofructose (sf) (see paper)
32% identity, 88% coverage: 42:393/398 of query aligns to 50:405/425 of 7ag4D
8h1lB Crystal structure of glucose-2-epimerase in complex with d-glucitol from runella slithyformis runsl_4512 (see paper)
25% identity, 91% coverage: 20:382/398 of query aligns to 21:404/423 of 8h1lB
3wkiA Crystal structure of cellobiose 2-epimerase in complex with cellobiitol (see paper)
24% identity, 98% coverage: 4:394/398 of query aligns to 4:400/407 of 3wkiA
3wkhA Crystal structure of cellobiose 2-epimerase in complex with epilactose (see paper)
24% identity, 98% coverage: 4:394/398 of query aligns to 4:400/410 of 3wkhA
3wkgA Crystal structure of cellobiose 2-epimerase in complex with glucosylmannose (see paper)
24% identity, 98% coverage: 4:394/398 of query aligns to 4:400/410 of 3wkgA
7d5gA Crystal structure of the csce with ligand to have a insight into the catalytic mechanism
22% identity, 97% coverage: 8:392/398 of query aligns to 5:387/389 of 7d5gA
P0DKY4 Cellobiose 2-epimerase; CE; EC 5.1.3.11 from Ruminococcus albus (see paper)
23% identity, 91% coverage: 30:391/398 of query aligns to 23:383/389 of P0DKY4
8wbvA The crystal structure of linear mannose with mutant h247f of the cellobiose 2-epimerase from caldicellulosiruptor saccharolyticus
22% identity, 97% coverage: 8:392/398 of query aligns to 7:389/391 of 8wbvA
8wbuA The crystal structure of circular mannose with mutant h247f of the cellobiose 2-epimerase from caldicellulosiruptor saccharolyticus
22% identity, 97% coverage: 8:392/398 of query aligns to 7:389/391 of 8wbuA
>SMa0058 FitnessBrowser__Smeli:SMa0058
MKPIPDFRSKDFLLAHMREIMDFYHPICLNEEDGGYYNEYRDDGFITDRKTQHLVSTTRF
IFNYATAAVLFERPDFAEAAAHGVRYLDEVHRDPEHGGYYWLMRGRDAVDATKHCYGHAF
VLLAYATAMKAGIPGTGARVSQTWDLLENRFWEPDRELYKDEVSRDWGATSPYRGQNANM
HMTEAMLAAYEATGEIRYLDRAETLARRICVELAANTQDVVWEHYRQDWSVDWDYNKDDP
KHLFRPYGYQPGHMTEWTKLLLILERYRPQDWLLPKALLLYETALAKSADLEFGGMHYSY
GPEGKLYDLDKYHWVHCETIAAAAALAGRTGRERYWQDYDRLWRYSWRHLIDHEYGCWFR
ILSPDGVKQSDIKSPSGKTDYHPFGACYEILRVLGEAQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory