Comparing SMa0196 FitnessBrowser__Smeli:SMa0196 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3dr2A Structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways (see paper)
43% identity, 90% coverage: 22:294/304 of query aligns to 32:296/299 of 3dr2A
3e5zA X-ray structure of the putative gluconolactonase in protein family pf08450. Northeast structural genomics consortium target drr130.
39% identity, 95% coverage: 12:300/304 of query aligns to 7:287/290 of 3e5zA
Q9A9Z1 D-xylonolactone lactonase; Xylono-1,5-lactonase; EC 3.1.1.110 from Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) (see paper)
29% identity, 86% coverage: 31:290/304 of query aligns to 7:255/289 of Q9A9Z1
7pldB Caulobacter crescentus xylonolactonase with (r)-4-hydroxy-2- pyrrolidone (see paper)
29% identity, 86% coverage: 31:290/304 of query aligns to 7:255/289 of 7pldB
7plbB Caulobacter crescentus xylonolactonase with d-xylose (see paper)
29% identity, 86% coverage: 31:290/304 of query aligns to 7:255/289 of 7plbB
Q15493 Regucalcin; RC; Gluconolactonase; GNL; Senescence marker protein 30; SMP-30; EC 3.1.1.17 from Homo sapiens (Human) (see 2 papers)
27% identity, 87% coverage: 27:289/304 of query aligns to 10:264/299 of Q15493
4gncA Human smp30/gnl-1,5-ag complex (see paper)
27% identity, 87% coverage: 27:289/304 of query aligns to 9:263/298 of 4gncA
Sites not aligning to the query:
3g4hA Crystal structure of human senescence marker protein-30 (zinc bound) (see paper)
27% identity, 87% coverage: 27:289/304 of query aligns to 8:262/297 of 3g4hA
4gnaA Mouse smp30/gnl-xylitol complex (see paper)
28% identity, 85% coverage: 32:289/304 of query aligns to 13:262/297 of 4gnaA
4gn9A Mouse smp30/gnl-glucose complex (see paper)
28% identity, 85% coverage: 32:289/304 of query aligns to 13:262/297 of 4gn9A
4gn8A Mouse smp30/gnl-1,5-ag complex (see paper)
28% identity, 85% coverage: 32:289/304 of query aligns to 13:262/297 of 4gn8A
Sites not aligning to the query:
4gn7A Mouse smp30/gnl (see paper)
28% identity, 85% coverage: 32:289/304 of query aligns to 13:262/297 of 4gn7A
8dk0A Crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound (s)gamma- valerolactone (see paper)
23% identity, 85% coverage: 27:285/304 of query aligns to 6:268/293 of 8dk0A
8djzA Crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound product (see paper)
23% identity, 85% coverage: 27:285/304 of query aligns to 6:268/293 of 8djzA
8djfA Crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound tetrahedral intermediate (see paper)
23% identity, 85% coverage: 27:285/304 of query aligns to 6:268/293 of 8djfA
7risA Crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound phosphate (see paper)
23% identity, 85% coverage: 27:285/304 of query aligns to 4:268/293 of 7risA
7rizA Crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound 2-hydroxyquinoline (see paper)
23% identity, 85% coverage: 27:285/304 of query aligns to 4:281/306 of 7rizA
2dsoC Crystal structure of d138n mutant of drp35, a 35kda drug responsive protein from staphylococcus aureus (see paper)
28% identity, 48% coverage: 121:267/304 of query aligns to 135:269/323 of 2dsoC
Sites not aligning to the query:
Q99QV3 Lactonase drp35; EC 3.1.1.- from Staphylococcus aureus (strain Mu50 / ATCC 700699) (see paper)
28% identity, 48% coverage: 121:267/304 of query aligns to 137:271/324 of Q99QV3
Sites not aligning to the query:
Q9M1B4 Protein STRICTOSIDINE SYNTHASE-LIKE 13; AtSSL13; Protein LESS ADHERENT POLLEN 3; Strictosidine synthase 11; AtSS11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
26% identity, 47% coverage: 103:246/304 of query aligns to 181:315/403 of Q9M1B4
Sites not aligning to the query:
>SMa0196 FitnessBrowser__Smeli:SMa0196
MAEASIYEIHDPRFRQMIVTSAGLDELYSGCRWAEGPVWFNDANQLLWSDIPNQRILRWT
PEGGVSVYRQPSNFTNGHTRDRRGRLISCEHGTRRVTRTEVDGSITVLADRFEGRRLNSP
NDVVVKSDGTIWFTDPTYGIMSDYEGYHADPEQPTRNVYRLDPETGELSAVVTDFTQPNG
LAFSPDEKILYVADSSASHDDRLPRHIRAFDLTDGGRLANGRVFCVIDKGIPDGIRTDAN
GNLWSSAGDGVHCFDTAGKLIGKIRVPQTVANLTFGGPRRNRLFIAATRSLYSVYVAVTG
SQVP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory