Comparing SMa0218 FitnessBrowser__Smeli:SMa0218 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ru1A Crystal structure of carbohydrate transporter acei_1806 from acidothermus cellulolyticus 11b, target efi-510965, in complex with myo-inositol
30% identity, 88% coverage: 32:308/316 of query aligns to 9:279/288 of 4ru1A
2h3hA Crystal structure of the liganded form of thermotoga maritima glucose binding protein (see paper)
29% identity, 79% coverage: 42:290/316 of query aligns to 14:260/313 of 2h3hA
Sites not aligning to the query:
3c6qC Apo and ligand-bound form of a thermophilic glucose/xylose binding protein
30% identity, 79% coverage: 42:290/316 of query aligns to 14:260/305 of 3c6qC
Sites not aligning to the query:
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
30% identity, 79% coverage: 39:287/316 of query aligns to 13:260/287 of 5dteB
Sites not aligning to the query:
4zjpA Structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose
28% identity, 73% coverage: 42:272/316 of query aligns to 16:241/270 of 4zjpA
Sites not aligning to the query:
7x0hA Crystal structure of sugar binding protein cbpa complexed wtih glucose from clostridium thermocellum (see paper)
26% identity, 84% coverage: 32:295/316 of query aligns to 12:273/287 of 7x0hA
1rpjA Crystal structure of d-allose binding protein from escherichia coli (see paper)
28% identity, 79% coverage: 42:291/316 of query aligns to 15:273/288 of 1rpjA
Sites not aligning to the query:
1gudA Hinge-bending motion of d-allose binding protein from escherichia coli: three open conformations (see paper)
28% identity, 79% coverage: 42:291/316 of query aligns to 15:273/288 of 1gudA
Sites not aligning to the query:
1dbpA Identical mutations at corresponding positions in two homologous proteins with non-identical effects (see paper)
28% identity, 72% coverage: 42:268/316 of query aligns to 15:237/271 of 1dbpA
Sites not aligning to the query:
5hqjA Crystal structure of abc transporter solute binding protein b1g1h7 from burkholderia graminis c4d1m, target efi-511179, in complex with d-arabinose
27% identity, 81% coverage: 39:295/316 of query aligns to 16:275/289 of 5hqjA
Sites not aligning to the query:
8wlbA X-ray structure of enterobacter cloacae allose-binding protein in complex with d-psicose (see paper)
28% identity, 72% coverage: 42:268/316 of query aligns to 15:249/288 of 8wlbA
Sites not aligning to the query:
8wl9A X-ray structure of enterobacter cloacae allose-binding protein in complex with d-ribose (see paper)
28% identity, 72% coverage: 42:268/316 of query aligns to 15:249/288 of 8wl9A
Sites not aligning to the query:
4irxA Crystal structure of caulobacter myo-inositol binding protein bound to myo-inositol (see paper)
25% identity, 88% coverage: 32:308/316 of query aligns to 12:296/296 of 4irxA
7e7mC Crystal structure analysis of the streptococcus agalactiae ribose binding protein rbsb
25% identity, 74% coverage: 42:276/316 of query aligns to 22:251/284 of 7e7mC
Sites not aligning to the query:
6guqA Crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with glucose
26% identity, 76% coverage: 42:280/316 of query aligns to 15:252/278 of 6guqA
Sites not aligning to the query:
6gt9A Crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with galactose
26% identity, 76% coverage: 42:280/316 of query aligns to 20:257/283 of 6gt9A
Sites not aligning to the query:
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
27% identity, 77% coverage: 42:285/316 of query aligns to 14:251/274 of 2ioyA
Sites not aligning to the query:
5xssA Xylfii molecule (see paper)
27% identity, 64% coverage: 76:276/316 of query aligns to 52:250/274 of 5xssA
Sites not aligning to the query:
P0AEE5 D-galactose/methyl-galactoside binding periplasmic protein MglB; D-galactose-binding periplasmic protein; GBP; D-galactose/D-glucose-binding protein; GGBP from Escherichia coli (strain K12) (see 4 papers)
28% identity, 82% coverage: 7:264/316 of query aligns to 4:277/332 of P0AEE5
Sites not aligning to the query:
2qw1A Glucose/galactose binding protein bound to 3-o-methyl d-glucose (see paper)
28% identity, 70% coverage: 43:264/316 of query aligns to 15:253/305 of 2qw1A
>SMa0218 FitnessBrowser__Smeli:SMa0218
MKLTRLRTAALAAGLATLLTSTALAADVKATMIIYLDPSVQFFNPVVKGAQDAAAQFGVD
LDVQYANNDPVRQNDLIESATASGVDGIAVAISSSDAFDESICAAVKAGIIVIGFNNDDL
DGAKGNCRQAYVGMDELASGYELGNRMIKEFGLKSGDVVFNPREIPEASFAVARGGGIEK
AMTENGIKVETVRAGLDPAEAQNIIAQFLIANPNVKALFGTGSVTSTVGAGAIKDAGVDI
PFGGFDLAVEIVNAVESGAMYATMDQQPYLQGYYPIAQIALAKKYGLTPTDIDTGQGAFL
DKTRIGSVKPLIGSYR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory