SitesBLAST
Comparing SMa0228 FitnessBrowser__Smeli:SMa0228 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5gudA Glutamate dehydrogenase from corynebacterium glutamicum (alpha- iminoglutarate/NADP+ complex) (see paper)
66% identity, 100% coverage: 1:448/448 of query aligns to 1:447/447 of 5gudA
- active site: K128 (= K128), D168 (= D168)
- binding (2Z)-2-iminopentanedioic acid: K92 (= K92), G93 (= G93), G94 (= G94), Q113 (= Q113), K116 (= K116), K128 (= K128), A166 (= A166), R208 (= R208), V376 (= V377), S379 (= S380)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: K136 (≠ R136), D168 (= D168), I169 (= I169), R208 (= R208), T212 (= T212), S241 (= S241), G242 (= G242), N243 (= N243), V244 (= V244), D264 (= D264), S265 (= S265), R290 (= R290), A321 (= A322), T322 (= T323), G345 (= G346), A346 (= A347), N347 (= N348), N372 (= N373)
5ijzA Crystal structure of glutamate dehydrogenase(gdh) from corynebacterium glutamicum (see paper)
66% identity, 100% coverage: 1:448/448 of query aligns to 1:447/447 of 5ijzA
- active site: K128 (= K128), D168 (= D168)
- binding 2-oxoglutaric acid: K92 (= K92), G93 (= G93), G94 (= G94), Q113 (= Q113), K116 (= K116), K128 (= K128), A166 (= A166), R208 (= R208), V376 (= V377), S379 (= S380)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: K136 (≠ R136), D168 (= D168), I169 (= I169), T212 (= T212), S241 (= S241), G242 (= G242), N243 (= N243), V244 (= V244), D264 (= D264), S265 (= S265), R290 (= R290), A321 (= A322), T322 (= T323), A346 (= A347), N347 (= N348), N372 (= N373)
5gudE Glutamate dehydrogenase from corynebacterium glutamicum (alpha- iminoglutarate/NADP+ complex) (see paper)
66% identity, 100% coverage: 1:448/448 of query aligns to 14:460/460 of 5gudE
- active site: K141 (= K128), D181 (= D168)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: T225 (= T212), S254 (= S241), G255 (= G242), N256 (= N243), V257 (= V244), D277 (= D264), S278 (= S265), R303 (= R290), A334 (= A322), T335 (= T323), A359 (= A347), N360 (= N348)
P00370 NADP-specific glutamate dehydrogenase; NADP-GDH; EC 1.4.1.4 from Escherichia coli (strain K12) (see 2 papers)
59% identity, 100% coverage: 1:448/448 of query aligns to 1:447/447 of P00370
- K92 (= K92) mutation to S: Complete loss of dehydrogenase activity.
- K128 (= K128) mutation to H: Reduces catalytic activity and increases pH optima for activity. Increases relative activity with amino acid substrates other than glutamate, especially L-norvaline.; mutation to R: Reduced catalytic activity and increases pH optima for activity. NADP-specific glutamate dehydrogenase.
1bgvA Glutamate dehydrogenase (see paper)
49% identity, 98% coverage: 10:447/448 of query aligns to 7:447/449 of 1bgvA
P24295 NAD-specific glutamate dehydrogenase; NAD-GDH; EC 1.4.1.2 from Clostridium symbiosum (Bacteroides symbiosus) (see 4 papers)
49% identity, 98% coverage: 10:447/448 of query aligns to 8:448/450 of P24295
- K90 (= K92) binding ; mutation to L: Increased substrate activity for methionine and norleucine but negligible activity with either glutamate or leucine. Dramatic reduction in the dehydrogenase activity with glutamate as the substrate; when associated with V-381.
- Q111 (= Q113) binding
- K114 (= K116) binding
- K126 (= K128) active site, Proton donor
- G165 (= G167) binding
- D166 (= D168) mutation to S: Dramatic reduction in the dehydrogenase activity. Specific activity is decreased 1000-fold in the reductive amination reaction and 100000-fold for oxidative deamination.
- S381 (= S380) binding ; mutation to V: Dramatic reduction in the dehydrogenase activity with glutamate as the substrate; when associated with L-90.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
7ecsA Crystal structure of aspergillus terreus glutamate dehydrogenase (atgdh) complexed with malonate and NADPH (see paper)
52% identity, 95% coverage: 21:446/448 of query aligns to 7:457/460 of 7ecsA
- binding malonate ion: G79 (= G93), G80 (= G94), Q99 (= Q113), K102 (= K116), K114 (= K128), S326 (≠ T328), G327 (= G329), E328 (≠ K330), T350 (= T352), A352 (≠ E354)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: K122 (≠ R136), D154 (= D168), I155 (= I169), R193 (= R208), T197 (= T212), S229 (= S241), G230 (= G242), N231 (= N243), V232 (= V244), D252 (= D264), S253 (= S265), K279 (= K284), A320 (= A322), T321 (= T323), G344 (= G346), S345 (≠ A347), N346 (= N348), N379 (= N373)
7ecrA Crystal structure of aspergillus terreus glutamate dehydrogenase (atgdh) complexed with succinate and adp-ribose (see paper)
52% identity, 95% coverage: 21:446/448 of query aligns to 7:457/460 of 7ecrA
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4r,5r)-3,4,5-trihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: K122 (≠ R136), D154 (= D168), I155 (= I169), S229 (= S241), G230 (= G242), N231 (= N243), V232 (= V244), D252 (= D264), S253 (= S265), K279 (= K284), A320 (= A322), T321 (= T323), G344 (= G346), S345 (≠ A347), N346 (= N348), N379 (= N373)
5xwcA Crystal structure of aspergillus niger glutamate dehydrogenase complexed with alpha-iminoglutarate, 2-amino-2-hydroxyglutarate and NADP (see paper)
52% identity, 95% coverage: 21:446/448 of query aligns to 6:456/459 of 5xwcA
- binding (2Z)-2-iminopentanedioic acid: K77 (= K92), G78 (= G93), Q98 (= Q113), K101 (= K116), K113 (= K128), A151 (= A166), R192 (= R208), V382 (= V377), S385 (= S380)
- binding (2S)-2-azanyl-2-oxidanyl-pentanedioic acid: K77 (= K92), G78 (= G93), G79 (= G94), Q98 (= Q113), K101 (= K116), K113 (= K128), A151 (= A166), D153 (= D168), R192 (= R208), V382 (= V377), S385 (= S380)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: H83 (= H98), K121 (≠ R136), D153 (= D168), I154 (= I169), R192 (= R208), T196 (= T212), S228 (= S241), G229 (= G242), N230 (= N243), V231 (= V244), D251 (= D264), S252 (= S265), A319 (= A322), T320 (= T323), G343 (= G346), S344 (≠ A347), N345 (= N348), N378 (= N373)
5xw0A Crystal structure of aspergillus niger glutamate dehydrogenase complexed with isophthalate and NADPH (see paper)
52% identity, 95% coverage: 21:446/448 of query aligns to 6:456/459 of 5xw0A
- binding benzene-1,3-dicarboxylic acid: K77 (= K92), G78 (= G93), Q98 (= Q113), K101 (= K116), K113 (= K128), A151 (= A166), G152 (= G167), D153 (= D168), R192 (= R208), S385 (= S380)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: H83 (= H98), K121 (≠ R136), D153 (= D168), I154 (= I169), R192 (= R208), T196 (= T212), S228 (= S241), G229 (= G242), N230 (= N243), V231 (= V244), D251 (= D264), S252 (= S265), A319 (= A322), T320 (= T323), G343 (= G346), S344 (≠ A347), N345 (= N348), N378 (= N373)
5xvxA Crystal structure of aspergillus niger glutamate dehydrogenase complexed with alpha-ketoglutarate and NADPH (see paper)
52% identity, 95% coverage: 21:446/448 of query aligns to 6:456/459 of 5xvxA
- binding 2-oxoglutaric acid: K77 (= K92), Q98 (= Q113), K101 (= K116), K113 (= K128), A151 (= A166), R192 (= R208), V382 (= V377), S385 (= S380)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: K121 (≠ R136), D153 (= D168), I154 (= I169), R192 (= R208), T196 (= T212), S228 (= S241), G229 (= G242), N230 (= N243), V231 (= V244), D251 (= D264), S252 (= S265), A319 (= A322), T320 (= T323), G343 (= G346), S344 (≠ A347), N345 (= N348), N378 (= N373)
5xvvB Crystal structure of forward inhibited aspergillus niger glutamate dehydrogenase with both apo- and alpha ketoglutarate bound subunits (see paper)
52% identity, 95% coverage: 21:446/448 of query aligns to 6:456/459 of 5xvvB
7f79C Crystal structure of glutamate dehydrogenase 3 from candida albicans in complex with alpha-ketoglutarate and NADPH (see paper)
51% identity, 94% coverage: 21:442/448 of query aligns to 8:451/458 of 7f79C
- binding 2-oxoglutaric acid: K79 (= K92), G80 (= G93), G81 (= G94), Q100 (= Q113), K103 (= K116), K115 (= K128), V380 (= V377), S383 (= S380)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R83 (= R96), H85 (= H98), K123 (≠ R136), D155 (= D168), I156 (= I169), R194 (= R208), T198 (= T212), S230 (= S241), G231 (= G242), N232 (= N243), V233 (= V244), D253 (= D264), S254 (= S265), K276 (≠ R287), A321 (= A322), T322 (= T323), G345 (= G346), S346 (≠ A347), N347 (= N348), N376 (= N373)
P00369 NADP-specific glutamate dehydrogenase; NADP-GDH; NADP-dependent glutamate dehydrogenase; EC 1.4.1.4 from Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) (see paper)
50% identity, 95% coverage: 21:446/448 of query aligns to 7:448/454 of P00369
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylserine
P78804 NADP-specific glutamate dehydrogenase; NADP-GDH; NADP-dependent glutamate dehydrogenase; EC 1.4.1.4 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
50% identity, 95% coverage: 21:446/448 of query aligns to 6:448/451 of P78804
- S252 (= S265) modified: Phosphoserine
P39633 Catabolic NAD-specific glutamate dehydrogenase RocG; NAD-GDH; Glutamate dehydrogenase; GlutDH; Trigger enzyme RocG; EC 1.4.1.2 from Bacillus subtilis (strain 168) (see 2 papers)
32% identity, 88% coverage: 50:441/448 of query aligns to 38:417/424 of P39633
- E93 (≠ I105) mutation to K: Reduces the affinity for glutamate and ammonium.
- D122 (≠ N134) mutation to N: Unable to control gltAB expression via an inhibitory interactions with the transcriptional regulator GltC. Reduces the affinity for glutamate and ammonium.
- Q144 (≠ R156) mutation to R: Increase of thermostability 20 degrees Celsius higher than that of the wild-type.
- Y158 (≠ G170) mutation to H: Reduces the affinity for glutamate and ammonium.
- S234 (≠ I246) mutation to R: Reduces the affinity for glutamate and ammonium.
- A324 (≠ G346) mutation to R: No effect.
Sites not aligning to the query:
- 27 E→F: Increase of thermostability 8 degrees Celsius higher than that of the wild-type.
3aoeB Crystal structure of hetero-hexameric glutamate dehydrogenase from thermus thermophilus (leu bound form)
34% identity, 97% coverage: 6:441/448 of query aligns to 2:416/424 of 3aoeB
Sites not aligning to the query:
3aogA Crystal structure of glutamate dehydrogenase (gdhb) from thermus thermophilus (glu bound form)
34% identity, 95% coverage: 15:441/448 of query aligns to 6:413/421 of 3aogA
Sites not aligning to the query:
8xcoA Cryo-em structure of glutamate dehydrogenase from thermococcus profundus incorporating NADPH in the initial stage of reaction
34% identity, 95% coverage: 24:448/448 of query aligns to 4:414/416 of 8xcoA
8xcsA Cryo-em structure of glutamate dehydrogenase from thermococcus profundus in complex with NADPH, akg and nh4 in the initial stage of reaction
34% identity, 95% coverage: 24:448/448 of query aligns to 6:416/418 of 8xcsA
- binding 2-oxoglutaric acid: K68 (= K92), G70 (= G94), M89 (≠ Q113), K92 (= K116), K104 (= K128), A142 (= A166), D144 (= D168), G346 (= G376), S350 (= S380)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R72 (= R96), K112 (≠ R136), P143 (≠ G167), D144 (= D168), V145 (≠ I169), Y146 (≠ G170), T190 (= T212), Y219 (≠ S241), G220 (= G242), N221 (= N243), A222 (≠ V244), D243 (= D264), S244 (= S265), K263 (= K284), A295 (= A322), I296 (≠ T323), N318 (= N348)
Query Sequence
>SMa0228 FitnessBrowser__Smeli:SMa0228
MNVDEKLEPILAEVLRRNGGEHEFHQAVREVLESLGRVIAKHPRYAENALIERICEPERQ
IIFRVPWVDDKGQVQINRGFRVQFNSALGPYKGGIRFHPSVNIGIIKFLGFEQTFKNALT
GMPIGGGKGGSDFNPRGRSDGEIMRFCQSLMTELHRHLGEYTDVPAGDIGVGGREIGYMF
GQYKRLTNRYEAGVLTGKALFYGGSRARKEATGYGATYFVQRMIATKGLDFEGKRVTVSG
SGNVAIYTMEKVIEFGGKIVACSDSNGYVVDEDGIDLELVKEIKEVRRERISEYARLKGA
GTHYIEAGSVWDVPCDVAMPSATQNELTGKDARTLVKNGVLAVGEGANMPCTPEAVRIFQ
EAGVLFAPGKAANAGGVATSALEMQQNASRDSWTFEQTEARLATIMQAIHDRCAETAEEY
GTPGDYVLGANIAGFVRVAEAMDALGVI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory