SitesBLAST
Comparing SMa0237 FitnessBrowser__Smeli:SMa0237 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3w6zA Crystal structure of NADP bound l-serine 3-dehydrogenase (k170m) from hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
37% identity, 92% coverage: 6:275/293 of query aligns to 15:286/296 of 3w6zA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G11), L21 (≠ T12), G22 (= G13), I23 (≠ L14), M24 (= M15), N43 (= N34), R44 (= R35), T45 (≠ D36), K48 (= K39), V77 (≠ L68), S78 (≠ T69), D82 (≠ A73), Q85 (≠ E76), V133 (= V123), F244 (≠ G233), K245 (≠ A234), H248 (≠ N237), K251 (= K240)
3ws7A The 1.18 a resolution structure of l-serine 3-dehydrogenase complexed with NADP+ and sulfate ion from the hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
37% identity, 92% coverage: 6:275/293 of query aligns to 15:283/293 of 3ws7A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G11), L21 (≠ T12), G22 (= G13), I23 (≠ L14), M24 (= M15), N43 (= N34), R44 (= R35), T45 (≠ D36), K48 (= K39), M76 (= M67), V77 (≠ L68), S78 (≠ T69), D82 (≠ A73), Q85 (≠ E76), V133 (= V123), F241 (≠ G233), K242 (≠ A234), H245 (≠ N237), K248 (= K240)
- binding sulfate ion: T134 (≠ S124), G135 (= G125), K183 (= K172)
3pefA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with NADP+ (see paper)
34% identity, 97% coverage: 6:288/293 of query aligns to 3:287/287 of 3pefA
- binding glycerol: D67 (≠ N70), G123 (= G125), K171 (= K172), N175 (≠ Q176), M178 (≠ V179), L203 (≠ R204), G207 (≠ R208), N213 (≠ S214), A217 (≠ E218), F232 (≠ G233), H236 (≠ N237), K239 (= K240), R242 (≠ N243), R269 (≠ V270)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G13), I11 (≠ L14), M12 (= M15), N31 (= N34), R32 (= R35), S33 (≠ D36), K36 (= K39), M64 (= M67), L65 (= L68), A66 (≠ T69), A70 (= A73), E73 (= E76), T96 (≠ S98), V121 (= V123), G123 (= G125), S124 (≠ G126), A231 (≠ G232), F232 (≠ G233), H236 (≠ N237), K239 (= K240)
2cvzC Structure of hydroxyisobutyrate dehydrogenase from thermus thermophilus hb8 (see paper)
36% identity, 97% coverage: 6:288/293 of query aligns to 3:282/289 of 2cvzC
- active site: S117 (= S124), K165 (= K172), N168 (= N175), N169 (≠ Q176)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G11), L9 (≠ T12), G10 (= G13), A11 (≠ L14), M12 (= M15), N30 (= N34), R31 (= R35), T32 (≠ D36), C62 (≠ M67), L63 (= L68), P64 (≠ T69), E68 (≠ A73), E71 (= E76), S91 (= S98), V116 (= V123), F227 (≠ G233), K234 (= K240)
1wp4A Structure of tt368 protein from thermus thermophilus hb8 (see paper)
36% identity, 97% coverage: 6:288/293 of query aligns to 2:281/288 of 1wp4A
- active site: S116 (= S124), K164 (= K172), N167 (= N175), N168 (≠ Q176)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G11), L8 (≠ T12), G9 (= G13), A10 (≠ L14), M11 (= M15), N29 (= N34), R30 (= R35), T31 (≠ D36), K34 (= K39), C61 (≠ M67), L62 (= L68), P63 (≠ T69), E67 (≠ A73), S90 (= S98), V115 (= V123), T225 (≠ G232), F226 (≠ G233), K233 (= K240)
- binding sulfate ion: S116 (= S124), G117 (= G125), G118 (= G126), K164 (= K172)
5je8B The crystal structure of bacillus cereus 3-hydroxyisobutyrate dehydrogenase in complex with NAD (see paper)
29% identity, 95% coverage: 6:282/293 of query aligns to 5:285/294 of 5je8B
3q3cA Crystal structure of a serine dehydrogenase from pseudomonas aeruginosa pao1 in complex with NAD (see paper)
43% identity, 73% coverage: 6:220/293 of query aligns to 2:217/294 of 3q3cA
- binding nicotinamide-adenine-dinucleotide: G9 (= G13), H10 (≠ L14), M11 (= M15), F29 (≠ W33), D30 (≠ N34), L31 (≠ R35), M63 (= M67), L64 (= L68), P65 (≠ T69), T94 (≠ S98), V119 (= V123), G121 (= G125)
Sites not aligning to the query:
3pduA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with NADP+ (see paper)
32% identity, 97% coverage: 5:287/293 of query aligns to 2:286/287 of 3pduA
- binding glycerol: R242 (≠ N243), E246 (≠ A247), E246 (≠ A247), R250 (≠ E251)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G11), G10 (= G13), I11 (≠ L14), M12 (= M15), N31 (= N34), R32 (= R35), N33 (≠ D36), M64 (= M67), L65 (= L68), A66 (≠ T69), A70 (= A73), T96 (≠ S98), V121 (= V123), G123 (= G125), T124 (≠ G126), K171 (= K172), S231 (≠ G232), F232 (≠ G233), P233 (≠ A234), H236 (≠ N237), K239 (= K240)
Q9I5I6 NAD-dependent L-serine dehydrogenase; L-serine 3-dehydrogenase (NAD(+)); EC 1.1.1.387 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
42% identity, 73% coverage: 6:220/293 of query aligns to 3:219/298 of Q9I5I6
- P66 (≠ T69) binding
- T96 (≠ S98) binding ; mutation to A: Almost abolished activity.
- S122 (= S124) mutation to A: Strongly reduced activity.
- K171 (= K172) active site
- N175 (≠ Q176) mutation to A: Strongly reduced activity.
- W214 (≠ R215) mutation to A: Almost abolished activity.
- Y219 (≠ H220) mutation to A: Strongly reduced activity.
Sites not aligning to the query:
- 2:31 binding
- 246 binding ; K→A: Almost abolished activity.
- 247 D→A: Almost abolished activity.
2uyyA Structure of the cytokine-like nuclear factor n-pac
30% identity, 86% coverage: 6:258/293 of query aligns to 8:262/292 of 2uyyA
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4s)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: G15 (= G13), L16 (= L14), M17 (= M15), N36 (= N34), R37 (= R35), T38 (≠ D36), V70 (≠ L68), S71 (≠ T69), A75 (= A73), T101 (≠ S98), F237 (≠ G233), Y238 (≠ A234), Y241 (≠ N237), K244 (= K240)
Q49A26 Cytokine-like nuclear factor N-PAC; NPAC; 3-hydroxyisobutyrate dehydrogenase-like protein; Glyoxylate reductase 1 homolog; Nuclear protein NP60; Nuclear protein of 60 kDa; Nucleosome-destabilizing factor; hNDF; Putative oxidoreductase GLYR1 from Homo sapiens (Human) (see 3 papers)
30% identity, 86% coverage: 6:258/293 of query aligns to 269:523/553 of Q49A26
- 271:285 (vs. 8:22, 47% identical) binding
- T362 (≠ S98) binding
- M437 (≠ K172) mutation to K: Loss of tetramerization and protein stability.; mutation to N: No effect on tetramerization or protein stability.
- P496 (= P231) to L: decreased interaction with GATA4; decreased synergistic activation of GATA4 target genes transcription; detrimental effect on cardiomyocyte differentiation
- K505 (= K240) binding
Sites not aligning to the query:
- 214 D→A: Slightly reduced stimulation of KDM1B demethylase activity, but normal KDM1B-binding.
- 214:217 Interaction with histone H3
- 216 H→A: Slightly reduced stimulation of KDM1B demethylase activity, but normal KDM1B-binding.
- 216:225 Interaction with KDM1B
- 217 Required to promote KDM1B demethylase activity toward histone H3K4me1 and H3K4me2; F→A: Abolished stimulation of KDM1B demethylase activity, reduced affinity for histone H3 of the dimer with KDM1B, but normal KDM1B-binding.
- 219 H→A: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity; when associated with A-223.
- 220:222 FLL→AAA: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity.
- 223 S→A: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity; when associated with A-219.
Q8T079 Cytokine-like nuclear factor N-PAC; NPAC; Glyoxylate reductase 1 homolog; Nuclear protein NP60 homolog; Nucleosome-destabilizing factor; Putative oxidoreductase GLYR1 homolog from Drosophila melanogaster (Fruit fly) (see paper)
27% identity, 95% coverage: 9:285/293 of query aligns to 320:599/602 of Q8T079
Sites not aligning to the query:
- 8 modified: Phosphoserine
- 10 modified: Phosphoserine
- 224 modified: Phosphoserine
- 228 modified: Phosphoserine
- 243 modified: Phosphoserine
6jitB Complex structure of an imine reductase at 2.05 angstrom resolution
32% identity, 97% coverage: 4:288/293 of query aligns to 1:285/287 of 6jitB
3obbA Crystal structure of a possible 3-hydroxyisobutyrate dehydrogenase from pseudomonas aeruginosa pao1 (see paper)
42% identity, 73% coverage: 6:220/293 of query aligns to 3:218/295 of 3obbA
Sites not aligning to the query:
6jizB Apo structure of an imine reductase at 1.76 angstrom resolution
32% identity, 97% coverage: 4:288/293 of query aligns to 1:292/293 of 6jizB
6jizC Apo structure of an imine reductase at 1.76 angstrom resolution
32% identity, 97% coverage: 4:288/293 of query aligns to 2:293/295 of 6jizC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G9 (= G11), P12 (≠ L14), M13 (= M15), N32 (= N34), R33 (= R35), T34 (≠ D36), R37 (≠ K39), S65 (≠ M67), L66 (= L68), T67 (= T69), A71 (= A73), I75 (≠ V77), S92 (= S97), S93 (= S98), V118 (= V127), T120 (≠ G129), Y168 (≠ K172)
P0A9V8 3-sulfolactaldehyde reductase; SLA reductase; 4-hydroxybutyrate dehydrogenase; Gamma-hydroxybutyrate dehydrogenase; GHBDH; Succinic semialdehyde reductase; SSA reductase; EC 1.1.1.373; EC 1.1.1.61 from Escherichia coli (strain K12)
31% identity, 96% coverage: 7:286/293 of query aligns to 4:286/298 of P0A9V8
- QM 11:12 (≠ LM 14:15) binding
- D31 (≠ N34) binding
- L65 (= L68) binding
- T96 (≠ S98) binding
- G122 (≠ S124) mutation to S: 25-fold decrease in catalytic efficiency with SLA as substrate. 5-fold decrease in catalytic efficiency with NADH as substrate.
- R123 (≠ G125) binding ; mutation to G: 130-fold decrease in catalytic efficiency with SLA as substrate. 3-fold decrease in catalytic efficiency with NADH as substrate.
- T124 (≠ G126) mutation to G: 230-fold decrease in catalytic efficiency with SLA as substrate. 12-fold decrease in catalytic efficiency with NADH as substrate.
- NNYMS 174:178 (≠ NQQIV 175:179) binding
- K240 (= K240) binding
6smzC Crystal structure of sla reductase yihu from e. Coli in complex with nadh
31% identity, 96% coverage: 7:286/293 of query aligns to 3:285/295 of 6smzC
- binding nicotinamide-adenine-dinucleotide: G9 (= G13), Q10 (≠ L14), M11 (= M15), F29 (≠ W33), D30 (≠ N34), V31 (≠ R35), M63 (= M67), L64 (= L68), V73 (= V77), S94 (= S97), T95 (≠ S98), R122 (≠ G125)
6smyA Crystal structure of sla reductase yihu from e. Coli with nadh and product dhps
31% identity, 96% coverage: 7:286/293 of query aligns to 3:285/294 of 6smyA
5y8lB Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + NAD +(s)-3-hydroxyisobutyrate (s-hiba) (see paper)
38% identity, 90% coverage: 5:269/293 of query aligns to 2:272/290 of 5y8lB
- binding (2~{S})-2-methylpentanedioic acid: T129 (= T134), E149 (≠ A154), A152 (vs. gap), G153 (= G157), G153 (= G157), K154 (≠ R158)
- binding (2S)-2-methyl-3-oxidanyl-propanoic acid: S119 (= S124), G120 (= G125), W211 (≠ L217), F236 (≠ G233)
- binding nicotinamide-adenine-dinucleotide: G8 (= G11), G10 (= G13), N11 (≠ L14), M12 (= M15), F30 (≠ W33), D31 (≠ N34), P32 (≠ R35), M64 (= M67), L65 (= L68), T93 (≠ S98), G121 (= G126), K168 (= K172), L240 (≠ N237), K243 (= K240)
Query Sequence
>SMa0237 FitnessBrowser__Smeli:SMa0237
MSGKTKIAFLGTGLMGAPMARRLLGAGFSVTVWNRDAAKAEPLAADGADIAASPADAVAG
AAIVFTMLTNGQAVSEVLFERGVADSLAEGRIVVDCSSIAPQIAREHARRLAEKGIRHLD
APVSGGVVGAAAGTLAIMAGGDGAAVESLKEVFAVLGRVTHVGPSGAGQVCKLANQQIVA
VTIGAVAEAMVLVEAGGASRAAFRDAIRGGFAESRILELHGARMVERNFAPGGASNNQLK
DLNAVMAMADELSLELPLTRQVRQEFADFVESGGGEQDHSGLLLQLEKLNPRN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory