SitesBLAST
Comparing SMa0244 FitnessBrowser__Smeli:SMa0244 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
45% identity, 88% coverage: 54:476/481 of query aligns to 44:462/465 of 3pm9A
- active site: A149 (= A161), L159 (≠ M171)
- binding flavin-adenine dinucleotide: P69 (= P79), Q70 (= Q80), G71 (= G81), G72 (= G82), N73 (= N83), T74 (= T84), G75 (= G85), L76 (= L86), G79 (= G89), Q80 (≠ A90), L91 (= L103), L133 (= L145), G134 (= G146), A135 (= A147), C139 (= C151), T140 (≠ Q152), G142 (= G154), G143 (= G155), S146 (= S158), T147 (= T159), A149 (= A161), G150 (= G162), E200 (= E212), G201 (= G213), I205 (= I217), I206 (= I218), E423 (= E437)
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
40% identity, 90% coverage: 42:475/481 of query aligns to 39:461/467 of 6lpnB
- binding flavin-adenine dinucleotide: W40 (= W43), P76 (= P79), G78 (= G81), G79 (= G82), N80 (= N83), T81 (= T84), G82 (= G85), M83 (≠ L86), G86 (= G89), S87 (≠ A90), L140 (= L145), A142 (= A147), C146 (= C151), H147 (≠ Q152), G150 (= G155), N151 (= N156), A153 (≠ S158), T154 (= T159), G208 (= G213), I212 (= I217), I213 (= I218), E423 (= E437), N460 (= N474)
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
40% identity, 90% coverage: 42:475/481 of query aligns to 38:460/466 of 6lpxA
- binding 2-oxoglutaric acid: R333 (= R341), T337 (≠ N345), K348 (≠ R356), Y379 (= Y389), H381 (= H391), H388 (= H398), H423 (= H438)
- binding flavin-adenine dinucleotide: W39 (= W43), P75 (= P79), Q76 (= Q80), G77 (= G81), G78 (= G82), N79 (= N83), T80 (= T84), G81 (= G85), M82 (≠ L86), G85 (= G89), S86 (≠ A90), L139 (= L145), G140 (= G146), A141 (= A147), C145 (= C151), G149 (= G155), N150 (= N156), A152 (≠ S158), T153 (= T159), G157 (= G163), G207 (= G213), I212 (= I218), E422 (= E437), N459 (= N474)
- binding zinc ion: H381 (= H391), H388 (= H398), E422 (= E437)
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
40% identity, 90% coverage: 42:475/481 of query aligns to 38:460/466 of 6lpuA
- binding flavin-adenine dinucleotide: W39 (= W43), P75 (= P79), G77 (= G81), G78 (= G82), N79 (= N83), T80 (= T84), G81 (= G85), G85 (= G89), S86 (≠ A90), L139 (= L145), G140 (= G146), A141 (= A147), C145 (= C151), H146 (≠ Q152), G148 (= G154), G149 (= G155), N150 (= N156), A152 (≠ S158), T153 (= T159), A155 (= A161), E206 (= E212), G207 (= G213), I211 (= I217), I212 (= I218), E422 (= E437), N459 (= N474)
- binding (2s)-2-hydroxypentanedioic acid: R333 (= R341), T337 (≠ N345), K348 (≠ R356), Y379 (= Y389), H381 (= H391), H388 (= H398), H423 (= H438)
- binding zinc ion: H381 (= H391), H388 (= H398), E422 (= E437)
6lpqA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-malate (d-mal) (see paper)
40% identity, 90% coverage: 42:475/481 of query aligns to 38:460/466 of 6lpqA
- binding flavin-adenine dinucleotide: W39 (= W43), P75 (= P79), G77 (= G81), G78 (= G82), N79 (= N83), T80 (= T84), G81 (= G85), G85 (= G89), S86 (≠ A90), L139 (= L145), G140 (= G146), A141 (= A147), C145 (= C151), H146 (≠ Q152), G149 (= G155), N150 (= N156), A152 (≠ S158), T153 (= T159), A155 (= A161), G157 (= G163), E206 (= E212), G207 (= G213), I211 (= I217), I212 (= I218), E422 (= E437), N459 (= N474)
- binding d-malate: M82 (≠ L86), R333 (= R341), T337 (≠ N345), K348 (≠ R356), Y379 (= Y389), H381 (= H391), H388 (= H398), E422 (= E437), H423 (= H438)
- binding zinc ion: H381 (= H391), H388 (= H398), E422 (= E437)
6lppA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-2-hydroxyglutarate (d-2-hg) (see paper)
40% identity, 90% coverage: 42:475/481 of query aligns to 38:460/466 of 6lppA
- binding (2R)-2-hydroxypentanedioic acid: R333 (= R341), T337 (≠ N345), K348 (≠ R356), Y379 (= Y389), H381 (= H391), H388 (= H398), N390 (= N400), H423 (= H438)
- binding flavin-adenine dinucleotide: W39 (= W43), P75 (= P79), G77 (= G81), G78 (= G82), N79 (= N83), T80 (= T84), G81 (= G85), M82 (≠ L86), G85 (= G89), S86 (≠ A90), L139 (= L145), G140 (= G146), A141 (= A147), C145 (= C151), G149 (= G155), N150 (= N156), A152 (≠ S158), T153 (= T159), A155 (= A161), G157 (= G163), G207 (= G213), I212 (= I218), E422 (= E437), H423 (= H438)
- binding zinc ion: H381 (= H391), H388 (= H398), E422 (= E437)
Q8N465 D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39 from Homo sapiens (Human) (see 7 papers)
40% identity, 90% coverage: 42:475/481 of query aligns to 91:513/521 of Q8N465
- S109 (≠ T60) to W: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs142050154
- N127 (≠ V78) to K: in D2HGA1; uncertain significance; complete loss of catalytic activity; dbSNP:rs762857195
- G131 (= G82) to V: in D2HGA1; uncertain significance; complete loss of catalytic activity
- I147 (≠ V100) to S: in D2HGA1; uncertain significance; severe phenotype; almost complete loss of catalytic activity; dbSNP:rs121434361
- M153 (= M106) to T: in D2HGA1; uncertain significance; significant loss of catalytic activity; to V: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs1432270139
- C172 (= C125) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs773735172
- P189 (= P142) to L: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs587783517
- A205 (≠ S158) to V: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs750889931
- A231 (≠ P184) to V: in D2HGA1; uncertain significance; significant loss of catalytic activity
- G233 (= G186) to S: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs374535734
- D375 (≠ S330) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs267606759
- R386 (= R341) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- T390 (≠ N345) binding ; binding ; mutation to A: Significantly reduced catalytic activity.
- V399 (≠ H354) to M: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746519212
- K401 (≠ R356) binding ; binding ; mutation to A: Loss of catalytic activity.
- R419 (≠ E374) to H: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs199908032
- A426 (= A384) to T: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs146578303
- H434 (= H391) binding ; mutation to A: Loss of catalytic activity.
- G436 (= G393) to V: slight reduction in catalytic activity
- N439 (= N396) to D: in D2HGA1; uncertain significance; mild phenotype; moderate reduction in catalytic activity; dbSNP:rs121434362
- H441 (= H398) binding ; mutation to A: Loss of catalytic activity.
- N443 (= N400) binding ; mutation to A: Significantly reduced catalytic activity.
- V444 (= V401) to A: in D2HGA1; uncertain significance; severe phenotype; significant reduction in catalytic activity; dbSNP:rs121434360
- A446 (≠ P403) to V: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746956176
- E475 (= E437) binding ; mutation to A: Loss of catalytic activity.
- H476 (= H438) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- G477 (= G439) to R: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs1453924640
Sites not aligning to the query:
- 15 R → G: in dbSNP:rs4675887
- 169:521 natural variant: Missing (in D2HGA1; uncertain significance)
- 400:521 natural variant: Missing (in D2HGA1; uncertain significance; complete loss of catalytic activity)
P39976 D-2-hydroxyglutarate--pyruvate transhydrogenase DLD3; D-2HG--pyruvate transhydrogenase DLD3; (R)-2-hydroxyglutarate--pyruvate transhydrogenase; D-lactate dehydrogenase [cytochrome] 3; D-lactate ferricytochrome C oxidoreductase; D-LCR; EC 1.1.99.40; EC 1.1.2.4 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
36% identity, 95% coverage: 20:475/481 of query aligns to 35:492/496 of P39976
Sites not aligning to the query:
- 17 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
29% identity, 96% coverage: 19:479/481 of query aligns to 13:466/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ P79), G75 (= G81), S76 (≠ G82), G77 (≠ N83), T78 (= T84), G79 (= G85), L80 (= L86), A83 (≠ G89), C84 (≠ A90), P137 (≠ L145), G138 (= G146), E139 (≠ Q148), A142 (≠ C151), T143 (≠ Q152), G146 (= G155), N147 (= N156), S149 (= S158), T150 (= T159), A152 (= A161), G153 (= G162), E203 (= E212), G204 (= G213), I209 (= I218), E422 (= E437), H423 (= H438)
- binding fe (iii) ion: H377 (= H391), H384 (= H398), E422 (= E437)
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
31% identity, 88% coverage: 56:477/481 of query aligns to 45:454/459 of P9WIT1
- K354 (≠ S368) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
8jdzA Crystal structure of mldhd in complex with 2-keto-3-methylvaleric acid (see paper)
30% identity, 88% coverage: 53:476/481 of query aligns to 42:451/454 of 8jdzA
- binding (3S)-3-methyl-2-oxopentanoic acid: R318 (= R341), W322 (≠ N345), H369 (= H391), H376 (= H398), H413 (= H438)
- binding flavin-adenine dinucleotide: P68 (= P79), G70 (= G81), T71 (≠ G82), G72 (≠ N83), T73 (= T84), G74 (= G85), G78 (= G89), V79 (≠ A90), L90 (= L103), P132 (≠ L145), G133 (= G146), A134 (= A147), G140 (= G155), M141 (≠ N156), A143 (≠ S158), T144 (= T159), A146 (= A161), S147 (≠ G162), E200 (= E212), G201 (= G213), I206 (= I218), W322 (≠ N345), E412 (= E437), H413 (= H438), N449 (= N474)
- binding manganese (ii) ion: H369 (= H391), H376 (= H398), E412 (= E437)
Sites not aligning to the query:
8jdyA Crystal structure of mldhd in complex with 2-ketoisocaproic acid (see paper)
30% identity, 88% coverage: 53:476/481 of query aligns to 42:451/454 of 8jdyA
- binding 2-oxo-4-methylpentanoic acid: R318 (= R341), W322 (≠ N345), S336 (≠ R356), H369 (= H391), H376 (= H398), H413 (= H438)
- binding flavin-adenine dinucleotide: P68 (= P79), G70 (= G81), T71 (≠ G82), G72 (≠ N83), T73 (= T84), G74 (= G85), G78 (= G89), V79 (≠ A90), L90 (= L103), P132 (≠ L145), G133 (= G146), A134 (= A147), G140 (= G155), M141 (≠ N156), A143 (≠ S158), T144 (= T159), A146 (= A161), S147 (≠ G162), E200 (= E212), G201 (= G213), I206 (= I218), E412 (= E437), N449 (= N474)
- binding manganese (ii) ion: H369 (= H391), H376 (= H398), E412 (= E437)
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
30% identity, 88% coverage: 53:476/481 of query aligns to 42:452/455 of 8jdxA
- binding flavin-adenine dinucleotide: P68 (= P79), G70 (= G81), T71 (≠ G82), G72 (≠ N83), T73 (= T84), G74 (= G85), G78 (= G89), V79 (≠ A90), L90 (= L103), P132 (≠ L145), G133 (= G146), A134 (= A147), G140 (= G155), M141 (≠ N156), A143 (≠ S158), T144 (= T159), A146 (= A161), S147 (≠ G162), E200 (= E212), G201 (= G213), I206 (= I218), W322 (≠ N345), E413 (= E437), H414 (= H438), N450 (= N474)
- binding 3-methyl-2-oxobutanoic acid: R318 (= R341), H369 (= H391), H376 (= H398), H414 (= H438)
- binding manganese (ii) ion: H369 (= H391), H376 (= H398), E413 (= E437)
Sites not aligning to the query:
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
30% identity, 88% coverage: 53:476/481 of query aligns to 42:451/454 of 8jdvA
- binding 2-Ketohexanoic acid: V75 (≠ L86), R317 (= R341), W321 (≠ N345), H368 (= H391), H375 (= H398), H413 (= H438)
- binding flavin-adenine dinucleotide: P68 (= P79), G70 (= G81), T71 (≠ G82), G72 (≠ N83), T73 (= T84), G74 (= G85), G78 (= G89), V79 (≠ A90), L90 (= L103), P132 (≠ L145), G133 (= G146), A134 (= A147), G140 (= G155), M141 (≠ N156), A143 (≠ S158), T144 (= T159), A146 (= A161), S147 (≠ G162), E200 (= E212), G201 (= G213), I206 (= I218), W321 (≠ N345), Y322 (≠ E346), E412 (= E437), H413 (= H438), N449 (= N474)
- binding manganese (ii) ion: H368 (= H391), H375 (= H398), E412 (= E437)
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
30% identity, 88% coverage: 53:476/481 of query aligns to 42:452/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (= R341), W322 (≠ N345), H369 (= H391), H376 (= H398), H414 (= H438)
- binding flavin-adenine dinucleotide: P68 (= P79), G70 (= G81), T71 (≠ G82), G72 (≠ N83), T73 (= T84), G74 (= G85), G78 (= G89), V79 (≠ A90), L90 (= L103), P132 (≠ L145), G133 (= G146), A134 (= A147), G140 (= G155), M141 (≠ N156), A143 (≠ S158), T144 (= T159), A146 (= A161), S147 (≠ G162), E200 (= E212), G201 (= G213), I206 (= I218), W322 (≠ N345), E413 (= E437), N450 (= N474)
- binding manganese (ii) ion: H369 (= H391), H376 (= H398), E413 (= E437)
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
30% identity, 88% coverage: 53:476/481 of query aligns to 42:453/456 of 8jdsA
- binding flavin-adenine dinucleotide: P68 (= P79), G70 (= G81), T71 (≠ G82), G72 (≠ N83), T73 (= T84), G74 (= G85), G78 (= G89), V79 (≠ A90), L90 (= L103), P132 (≠ L145), G133 (= G146), A134 (= A147), G140 (= G155), M141 (≠ N156), A143 (≠ S158), T144 (= T159), A146 (= A161), S147 (≠ G162), E200 (= E212), G201 (= G213), I206 (= I218), W323 (≠ N345), E414 (= E437), H415 (= H438), N451 (= N474)
- binding manganese (ii) ion: H370 (= H391), H377 (= H398), E414 (= E437)
- binding pyruvic acid: R319 (= R341), H370 (= H391), H377 (= H398), H415 (= H438)
Sites not aligning to the query:
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
30% identity, 88% coverage: 53:476/481 of query aligns to 42:452/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (= R341), H369 (= H391), H376 (= H398), H414 (= H438)
- binding flavin-adenine dinucleotide: P68 (= P79), G70 (= G81), T71 (≠ G82), G72 (≠ N83), T73 (= T84), G74 (= G85), G78 (= G89), V79 (≠ A90), L90 (= L103), P132 (≠ L145), G133 (= G146), A134 (= A147), G140 (= G155), M141 (≠ N156), A143 (≠ S158), T144 (= T159), A146 (= A161), S147 (≠ G162), E200 (= E212), G201 (= G213), I206 (= I218), W322 (≠ N345), E413 (= E437), H414 (= H438), N450 (= N474)
- binding manganese (ii) ion: H369 (= H391), H376 (= H398), E413 (= E437)
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
30% identity, 88% coverage: 53:476/481 of query aligns to 42:452/455 of 8jdeA
- binding flavin-adenine dinucleotide: P68 (= P79), G70 (= G81), T71 (≠ G82), G72 (≠ N83), T73 (= T84), G74 (= G85), G78 (= G89), V79 (≠ A90), L90 (= L103), P132 (≠ L145), G133 (= G146), A134 (= A147), G140 (= G155), M141 (≠ N156), A143 (≠ S158), T144 (= T159), A146 (= A161), S147 (≠ G162), E200 (= E212), G201 (= G213), I206 (= I218), W322 (≠ N345), E413 (= E437), H414 (= H438), N450 (= N474)
- binding lactic acid: R318 (= R341), H369 (= H391), H376 (= H398), H414 (= H438)
- binding manganese (ii) ion: H369 (= H391), H376 (= H398), E413 (= E437)
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
30% identity, 88% coverage: 53:476/481 of query aligns to 42:453/456 of 8jdrA
- binding flavin-adenine dinucleotide: P68 (= P79), G70 (= G81), T71 (≠ G82), G72 (≠ N83), T73 (= T84), G74 (= G85), G78 (= G89), V79 (≠ A90), L90 (= L103), P132 (≠ L145), G133 (= G146), A134 (= A147), G140 (= G155), M141 (≠ N156), A143 (≠ S158), T144 (= T159), A146 (= A161), S147 (≠ G162), E200 (= E212), G201 (= G213), I206 (= I218), Y324 (≠ E346), H370 (= H391), E414 (= E437), N451 (= N474)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (= R341), W323 (≠ N345), H415 (= H438)
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
30% identity, 88% coverage: 53:476/481 of query aligns to 42:453/456 of 8jdqA
- binding (2R)-2-hydroxy-4-methylpentanoic acid: R319 (= R341), W323 (≠ N345), H370 (= H391), H415 (= H438)
- binding flavin-adenine dinucleotide: P68 (= P79), G70 (= G81), T71 (≠ G82), G72 (≠ N83), T73 (= T84), G74 (= G85), G78 (= G89), V79 (≠ A90), L90 (= L103), P132 (≠ L145), G133 (= G146), A134 (= A147), G140 (= G155), M141 (≠ N156), A143 (≠ S158), T144 (= T159), A146 (= A161), S147 (≠ G162), E200 (= E212), G201 (= G213), I206 (= I218), H370 (= H391), E414 (= E437), N451 (= N474)
Query Sequence
>SMa0244 FitnessBrowser__Smeli:SMa0244
MTSAGTIEDAKGPAELRLALRQMLGEDIVLSETEEMLRFCRDWHGDVTTGTVAVIRPRST
QQVAAAVKACRELGLSIVPQGGNTGLVLGAIPDAPERQVVLSLSRMNRIRKIDPADFSAV
VESGCILSELKDAIAKMGMFFPLALGAQGSCQIGGNVSTNAGGVNVLRYGMTRELVLGLE
VVLPDGSILEGLSTLRKDNRGIDLKQLFIGAEGTLGIITAVSITLTPYPDHVATALLGLA
SLEDAIRLYRRARRDCCDLMSAFEFMPPLAFTLAQEAMPDLPIPISAEYPAYVLMEISGS
GLVDVDDLMQRFLEGAMEEGLVLDGTIAASQTQARNLWLIREGMNEGQAKRGTHMRTDIS
VPLSQLASFVEEAEKAVSEALPGAVSVSYGHVGDGNVHLNVLPPAGSTPEERIQLIYKAK
TVVNEVLDRYTGSISAEHGIGRLKRPDFDARLPATRRKLLTALKHAVDPEMIMNPGCQLR
F
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory