Comparing SMa0259 FitnessBrowser__Smeli:SMa0259 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 17 hits to proteins with known functional sites (download)
Q8K4H1 Kynurenine formamidase; KFA; KFase; Arylformamidase; N-formylkynurenine formamidase; FKF; EC 3.5.1.9 from Mus musculus (Mouse) (see paper)
32% identity, 95% coverage: 11:278/281 of query aligns to 38:303/305 of Q8K4H1
4ob6A Complex structure of esterase rppe s159a/w187h and substrate (s)-ac- cpa (see paper)
27% identity, 55% coverage: 26:180/281 of query aligns to 34:194/319 of 4ob6A
Sites not aligning to the query:
5aobA The structure of a novel thermophilic esterase from the planctomycetes species, thermogutta terrifontis, est2-butyrate bound (see paper)
28% identity, 67% coverage: 66:254/281 of query aligns to 44:244/278 of 5aobA
5aocA The structure of a novel thermophilic esterase from the planctomycetes species, thermogutta terrifontis, est2-valerate bound (see paper)
28% identity, 67% coverage: 66:254/281 of query aligns to 48:243/277 of 5aocA
7bfrA Thermogutta terrifontis esterase 2 phosphorylated by paraoxon (see paper)
28% identity, 67% coverage: 66:254/281 of query aligns to 44:227/260 of 7bfrA
1qz3A Crystal structure of mutant m211s/r215l of carboxylesterase est2 complexed with hexadecanesulfonate (see paper)
33% identity, 48% coverage: 50:185/281 of query aligns to 61:195/309 of 1qz3A
Sites not aligning to the query:
Q8N0W4 Neuroligin-4, X-linked; Neuroligin X; HNLX from Homo sapiens (Human) (see 3 papers)
29% identity, 33% coverage: 59:152/281 of query aligns to 163:264/816 of Q8N0W4
Sites not aligning to the query:
B0F2B4 Neuroligin 4-like; Neuroligin-4; NL-4 from Mus musculus (Mouse) (see paper)
31% identity, 32% coverage: 63:151/281 of query aligns to 176:272/945 of B0F2B4
Sites not aligning to the query:
5mifC Crystal structure of carboxyl esterase 2 (tmelest2) from mycorrhizal fungus tuber melanosporum (see paper)
32% identity, 30% coverage: 63:146/281 of query aligns to 64:148/301 of 5mifC
Sites not aligning to the query:
P95125 Carboxylic ester hydrolase LipN; EC 3.1.1.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
33% identity, 39% coverage: 63:171/281 of query aligns to 135:247/376 of P95125
Sites not aligning to the query:
4po3X Crystal structure of a c4-c4 sn3 tributyrin phosphonate inhibited by esterase b from lactobacillus rhamnosis
29% identity, 45% coverage: 28:153/281 of query aligns to 36:156/309 of 4po3X
Sites not aligning to the query:
4n5iX Crystal structure of a c8-c4 sn3 inhibited esterase b from lactobacillus rhamnosis
29% identity, 45% coverage: 28:153/281 of query aligns to 33:153/311 of 4n5iX
Sites not aligning to the query:
4oukX Crystal structure of a c6-c4 sn3 inhibited esterase b from lactobacillus rhamnosis
29% identity, 45% coverage: 28:153/281 of query aligns to 33:153/309 of 4oukX
Sites not aligning to the query:
4v2iA Biochemical characterization and structural analysis of a new cold- active and salt tolerant esterase from the marine bacterium thalassospira sp (see paper)
24% identity, 40% coverage: 50:161/281 of query aligns to 64:176/315 of 4v2iA
Sites not aligning to the query:
6ieyA Crystal structure of chloramphenicol-metabolizaing enzyme estdl136- chloramphenicol complex (see paper)
29% identity, 36% coverage: 52:152/281 of query aligns to 55:156/307 of 6ieyA
Sites not aligning to the query:
P24484 Lipase 2; Triacylglycerol lipase; EC 3.1.1.3 from Moraxella sp. (strain TA144) (see paper)
30% identity, 35% coverage: 56:152/281 of query aligns to 152:249/433 of P24484
P71668 Esterase LipI; EC 3.1.1.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
28% identity, 43% coverage: 59:180/281 of query aligns to 81:201/320 of P71668
Sites not aligning to the query:
>SMa0259 FitnessBrowser__Smeli:SMa0259
MTAQDLYRIRDFVPDFDTIAAEFAERSWAVSARADVRADIRYGSGVREVIDLILPERVQA
GAPLHVFVHGGYWRSGEKINYRFVAAPVLAAGGIAALVEYDLMPGKRLDVLVDQVRRSVL
WLQAHAGDFGADPARLTVSGHSAGAHLASFLAATGPEEAYPPSLPTLQGLLLLSGIYDLS
GIPDSFLRHEAEMTPMEAAAWSPLTSSQLPCPLRIIAYGADETAPFQNQAAGLCELLRAQ
DKSAELLPVPDLNHMSIVLDLADTDGVLGRQLHDLVAQPTR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory