Comparing SMa0298 FitnessBrowser__Smeli:SMa0298 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
37% identity, 49% coverage: 4:301/604 of query aligns to 3:311/330 of P0AAH4
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
35% identity, 53% coverage: 1:318/604 of query aligns to 1:321/326 of Q8RDH4
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
35% identity, 52% coverage: 4:318/604 of query aligns to 3:310/310 of 4fwiB
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
35% identity, 43% coverage: 4:260/604 of query aligns to 3:251/253 of 7z15I
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
35% identity, 42% coverage: 4:259/604 of query aligns to 3:250/250 of 7z18I
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
34% identity, 42% coverage: 4:259/604 of query aligns to 3:250/250 of 7z16I
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
33% identity, 42% coverage: 4:255/604 of query aligns to 1:243/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
33% identity, 42% coverage: 3:255/604 of query aligns to 1:244/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
33% identity, 42% coverage: 3:255/604 of query aligns to 1:244/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
33% identity, 42% coverage: 3:255/604 of query aligns to 1:244/344 of 3tuiC
Q5M243 Energy-coupling factor transporter ATP-binding protein EcfA1; ECF transporter A component EcfA1; EC 7.-.-.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
35% identity, 41% coverage: 4:251/604 of query aligns to 1:228/276 of Q5M243
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
34% identity, 42% coverage: 4:256/604 of query aligns to 2:239/241 of 4u00A
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
37% identity, 35% coverage: 2:215/604 of query aligns to 3:208/233 of P75957
7arlD Lolcde in complex with lipoprotein and adp (see paper)
37% identity, 35% coverage: 4:215/604 of query aligns to 2:205/222 of 7arlD
7mdyC Lolcde nucleotide-bound
37% identity, 35% coverage: 4:215/604 of query aligns to 2:205/226 of 7mdyC
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
29% identity, 40% coverage: 18:259/604 of query aligns to 36:269/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
29% identity, 40% coverage: 18:259/604 of query aligns to 36:269/382 of 7aheC
Sites not aligning to the query:
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
37% identity, 35% coverage: 2:215/604 of query aligns to 2:207/229 of 7v8iD
7ahdC Opua (e190q) occluded (see paper)
29% identity, 39% coverage: 18:250/604 of query aligns to 36:260/260 of 7ahdC
Sites not aligning to the query:
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
31% identity, 45% coverage: 5:274/604 of query aligns to 4:262/353 of 1oxvD
>SMa0298 FitnessBrowser__Smeli:SMa0298
MKNLIEVRNLNIAYGGPSGWTNVVQDVSFEIAPGEAFGLVGESGCGKSTVAYRLLGYGTI
NSLVQTGEVLFDGTDLLKLDAASLMRLRGNRIAFVPQNPTTSLSPGMRVGSQICEMIATH
KALPDGMTMERRIVELFTLVGLPDVGHRYPHELSGGQQQRVTIAMAVACNPDLLVLDEPT
TGLDVTTQRQIIQLLADLRSRIGMAMLYVTHDLALLAQIADRVGVMYAGQLVEVAPCDKL
LSAPAHPYSRGLIASIPTNDGTDRQARSLRGMLRRDEMSTGCKFEPRCDFATGACRATPQ
LLELIEDARSVACMRWREATAPLAPSVTAKAVARTAVRSESLLSVTELSLSYQQPGLFNR
LLGRTSPAVVREINLNLAAGEVVALVGGSGSGKSTIARAISARLPPRAGIIRLDGTALAP
SLKDRSVEELRQIQYIFQNPDASLNPRGLRLFERTQELDDPCLYRNVERREDLVADQKLR
IDEKCAGCYSKPPLDSKRTITSHARPPFRGRRPYRASAVPSPAAVRARSAIHAPKTGHPS
RSRLPASSAAISLPKHWYATPPRQITTARRSRSDQCRDLARDRAQASRRSALRRSAADRT
ANSC
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory