SitesBLAST
Comparing SMa0329 FitnessBrowser__Smeli:SMa0329 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6vspA Structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a (see paper)
43% identity, 98% coverage: 4:250/253 of query aligns to 2:249/251 of 6vspA
- active site: G16 (= G18), S138 (= S140), Y151 (= Y153)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), N15 (≠ S17), G16 (= G18), M17 (≠ I19), D36 (≠ G38), W37 (≠ R39), W37 (≠ R39), A38 (≠ T40), I59 (≠ A61), D60 (≠ N62), V61 (= V63), N87 (≠ A89), A88 (= A90), G89 (= G91), V90 (≠ M92), V110 (≠ S112), T136 (≠ I138), S138 (= S140), Y151 (= Y153), K155 (= K157), P181 (= P183), S182 (≠ G184), L183 (= L185), V184 (≠ T186), T186 (= T188), N187 (≠ G189), M188 (= M190), T189 (≠ V191)
6vspB Structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a (see paper)
43% identity, 98% coverage: 4:250/253 of query aligns to 4:251/252 of 6vspB
H9XP47 Meso-2,3-butanediol dehydrogenase; BDH; meso-2,3-BDH; (R,S)-butane-2,3-diol dehydrogenase; NAD(H)-dependent meso-2,3-BDH; SmBdh; EC 1.1.1.- from Serratia marcescens (see paper)
43% identity, 98% coverage: 4:250/253 of query aligns to 2:249/251 of H9XP47
- N15 (≠ S17) binding
- M17 (≠ I19) binding
- D36 (≠ G38) binding
- D60 (≠ N62) binding
- V61 (= V63) binding
- N87 (≠ A89) binding
- S138 (= S140) binding ; binding
- V139 (= V141) mutation to Q: Retains 50% of activity with acetoin as substrate; when associated with A-247.
- S140 (= S142) binding
- Y151 (= Y153) binding ; binding ; binding
- K155 (= K157) binding
- V184 (≠ T186) binding
- T186 (= T188) binding
- RDK 197:199 (≠ LEK 201:203) mutation to SEAAGKPLGYGTET: Mimics longer alpha6 helix. Retains 3% of activity with acetoin as substrate.
- Q247 (≠ G248) mutation to A: Retains 10% of activity with acetoin as substrate. Retains 50% of activity with acetoin as substrate; when associated with Q-139.
6xewA Structure of serratia marcescens 2,3-butanediol dehydrogenase (see paper)
43% identity, 98% coverage: 4:250/253 of query aligns to 2:249/251 of 6xewA
- active site: G16 (= G18), S138 (= S140), Y151 (= Y153)
- binding r,3-hydroxybutan-2-one: S138 (= S140), S140 (= S142), Y151 (= Y153)
- binding s,3-hydroxybutan-2-one: S138 (= S140), Y151 (= Y153), S182 (≠ G184)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), N15 (≠ S17), G16 (= G18), M17 (≠ I19), D36 (≠ G38), W37 (≠ R39), W37 (≠ R39), A38 (≠ T40), I59 (≠ A61), D60 (≠ N62), V61 (= V63), N87 (≠ A89), A88 (= A90), G89 (= G91), V110 (≠ S112), T136 (≠ I138), S138 (= S140), Y151 (= Y153), K155 (= K157), S182 (≠ G184), L183 (= L185), V184 (≠ T186), T186 (= T188), N187 (≠ G189), M188 (= M190), T189 (≠ V191)
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
40% identity, 94% coverage: 5:243/253 of query aligns to 2:250/252 of 1vl8B
- active site: G17 (= G18), S143 (= S140), I154 (vs. gap), Y157 (= Y153), K161 (= K157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G14), R16 (≠ S17), G17 (= G18), L18 (≠ I19), S37 (≠ G38), R38 (= R39), C63 (≠ A61), D64 (≠ N62), V65 (= V63), A91 (= A89), A92 (= A90), G93 (= G91), I94 (≠ M92), V114 (≠ S112), I141 (= I138), S143 (= S140), Y157 (= Y153), K161 (= K157), P187 (= P183), G188 (= G184), Y190 (≠ T186), T192 (= T188), M194 (= M190), T195 (≠ V191)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
39% identity, 92% coverage: 8:241/253 of query aligns to 5:243/246 of 3osuA
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
37% identity, 94% coverage: 5:241/253 of query aligns to 6:243/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G14), S17 (≠ G16), R18 (≠ S17), I20 (= I19), T40 (≠ R39), N62 (= N62), V63 (= V63), N89 (≠ A89), A90 (= A90), I92 (≠ M92), V139 (≠ I138), S141 (= S140), Y154 (= Y153), K158 (= K157), P184 (= P183), G185 (= G184), I187 (≠ T186), T189 (= T188), M191 (= M190)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
35% identity, 94% coverage: 4:241/253 of query aligns to 4:241/244 of 4nbuB
- active site: G18 (= G18), N111 (≠ D113), S139 (= S140), Q149 (≠ H150), Y152 (= Y153), K156 (= K157)
- binding acetoacetyl-coenzyme a: D93 (≠ V95), K98 (≠ E100), S139 (= S140), N146 (≠ G147), V147 (≠ W148), Q149 (≠ H150), Y152 (= Y153), F184 (≠ L185), M189 (= M190), K200 (= K203)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G14), N17 (≠ S17), G18 (= G18), I19 (= I19), D38 (≠ G38), F39 (≠ R39), V59 (≠ A61), D60 (≠ N62), V61 (= V63), N87 (≠ A89), A88 (= A90), G89 (= G91), I90 (≠ M92), T137 (≠ I138), S139 (= S140), Y152 (= Y153), K156 (= K157), P182 (= P183), F184 (≠ L185), T185 (= T186), T187 (= T188), M189 (= M190)
1zk4A Structure of r-specific alcohol dehydrogenase (wildtype) from lactobacillus brevis in complex with acetophenone and NADP (see paper)
38% identity, 96% coverage: 2:244/253 of query aligns to 1:250/251 of 1zk4A
- active site: G17 (= G18), S142 (= S140), Y155 (= Y153), K159 (= K157)
- binding 1-phenylethanone: A93 (≠ N93), Y155 (= Y153), Y189 (≠ L185)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G14), T15 (≠ G16), L16 (≠ S17), I18 (= I19), T36 (≠ S37), G37 (= G38), R38 (= R39), H61 (≠ A61), D62 (≠ N62), N89 (≠ A89), A90 (= A90), G91 (= G91), I92 (≠ M92), Y155 (= Y153), G188 (= G184), I190 (≠ T186), T192 (= T188), L194 (≠ M190)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
38% identity, 94% coverage: 5:241/253 of query aligns to 3:244/247 of 4jroC
- active site: G16 (= G18), S142 (= S140), Q152 (≠ H150), Y155 (= Y153), K159 (= K157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), S14 (≠ G16), R15 (≠ S17), G16 (= G18), I17 (= I19), N35 (≠ S37), Y36 (≠ G38), N37 (≠ R39), G38 (≠ T40), S39 (≠ E41), N63 (= N62), V64 (= V63), N90 (≠ A89), A91 (= A90), I93 (≠ M92), I113 (≠ S112), S142 (= S140), Y155 (= Y153), K159 (= K157), P185 (= P183), I188 (≠ T186), T190 (= T188)
6y0sAAA R-specific alcohol dehydrogenase (see paper)
38% identity, 96% coverage: 2:244/253 of query aligns to 1:250/251 of 6y0sAAA
5ojiA Crystal structure of the dehydrogenase/reductase sdr family member 4 (dhrs4) from caenorhabditis elegans (see paper)
38% identity, 94% coverage: 3:241/253 of query aligns to 6:255/260 of 5ojiA
- active site: G21 (= G18), S148 (= S140), Y161 (= Y153), K165 (= K157)
- binding isatin: S148 (= S140), S150 (= S142), Y161 (= Y153), V193 (≠ L185), S199 (≠ V191), L202 (≠ I194)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A17 (≠ G14), T19 (≠ G16), I22 (= I19), S41 (≠ G38), R42 (= R39), N43 (≠ T40), N46 (≠ R43), I69 (≠ V63), N95 (≠ A89), H96 (≠ A90), G97 (= G91), N146 (≠ I138), S148 (= S140), Y161 (= Y153), K165 (= K157), G192 (= G184), I194 (≠ T186), T196 (= T188), M198 (= M190)
5ojgA Crystal structure of the dehydrogenase/reductase sdr family member 4 (dhrs4) from caenorhabditis elegans (see paper)
38% identity, 94% coverage: 3:241/253 of query aligns to 6:255/260 of 5ojgA
- active site: G21 (= G18), S148 (= S140), Y161 (= Y153), K165 (= K157)
- binding butane-2,3-dione: S148 (= S140), Y161 (= Y153)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A17 (≠ G14), T19 (≠ G16), G21 (= G18), I22 (= I19), S41 (≠ G38), R42 (= R39), N43 (≠ T40), N46 (≠ R43), I69 (≠ V63), N95 (≠ A89), H96 (≠ A90), G97 (= G91), N146 (≠ I138), S148 (= S140), Y161 (= Y153), K165 (= K157), P191 (= P183), I194 (≠ T186), T196 (= T188), M198 (= M190)
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
39% identity, 92% coverage: 8:241/253 of query aligns to 2:236/239 of 3sj7A
- active site: G12 (= G18), S138 (= S140), Q148 (≠ H150), Y151 (= Y153), K155 (= K157)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G14), S10 (≠ G16), R11 (≠ S17), I13 (= I19), N31 (≠ S37), Y32 (vs. gap), A33 (vs. gap), G34 (= G38), S35 (≠ R39), A58 (= A61), N59 (= N62), V60 (= V63), N86 (≠ A89), A87 (= A90), T109 (≠ S112), S138 (= S140), Y151 (= Y153), K155 (= K157), P181 (= P183), G182 (= G184)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
36% identity, 95% coverage: 8:247/253 of query aligns to 6:248/248 of Q9KJF1
- S15 (= S17) binding
- D36 (≠ G38) binding
- D62 (≠ N62) binding
- I63 (≠ V63) binding
- N89 (≠ A89) binding
- Y153 (= Y153) binding
- K157 (= K157) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
2cfcA Structural basis for stereo selectivity in the (r)- and (s)-hydroxypropylethane thiosulfonate dehydrogenases (see paper)
38% identity, 93% coverage: 8:243/253 of query aligns to 3:248/250 of 2cfcA
- active site: G13 (= G18), S142 (= S140), Y155 (= Y153), K159 (= K157)
- binding (2-[2-ketopropylthio]ethanesulfonate: F149 (≠ G147), R152 (≠ H150), Y155 (= Y153), W195 (≠ A193), R196 (≠ I194)
- binding nicotinamide-adenine-dinucleotide: G9 (= G14), S12 (= S17), G13 (= G18), N14 (≠ I19), D33 (≠ M35), L34 (≠ M36), A59 (= A61), D60 (≠ N62), V61 (= V63), N87 (≠ A89), A88 (= A90), G89 (= G91), I140 (= I138), P185 (= P183), G186 (= G184), M187 (≠ L185), I188 (≠ T186), T190 (= T188), P191 (≠ G189), M192 (= M190), T193 (≠ V191)
Q56840 2-(R)-hydroxypropyl-CoM dehydrogenase; R-HPCDH; 2-[(R)-2-hydroxypropylthio]ethanesulfonate dehydrogenase; Aliphatic epoxide carboxylation component III; Epoxide carboxylase component III; RHPCDH1; EC 1.1.1.268 from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) (see 4 papers)
38% identity, 93% coverage: 8:243/253 of query aligns to 3:248/250 of Q56840
- SGN 12:14 (≠ SGI 17:19) binding
- D33 (≠ M35) binding
- DV 60:61 (≠ NV 62:63) binding
- N87 (≠ A89) binding
- S142 (= S140) mutation to A: Retains weak activity. 120-fold decrease in kcat.; mutation to C: Loss of activity.
- R152 (≠ H150) binding ; mutation to A: Almost loss of activity with the natural substrate 2-KPC, but does not affect activity with 2-butanone as substrate.
- Y155 (= Y153) mutation Y->E,F: Loss of activity.
- K159 (= K157) mutation to A: Loss of activity.
- R179 (= R177) mutation to A: Loss of activity.
- IETPM 188:192 (≠ TVTGM 186:190) binding
- WR 195:196 (≠ AI 193:194) binding
- R196 (≠ I194) mutation to A: Almost loss of activity with the natural substrate 2-KPC, but does not affect activity with 2-butanone as substrate.
- R203 (≠ L201) mutation to A: Slight decrease in catalytic efficiency.
- R209 (= R207) mutation to A: Does not affect catalytic efficiency.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1zk1A Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and NAD (see paper)
37% identity, 96% coverage: 2:244/253 of query aligns to 1:250/251 of 1zk1A
- active site: G17 (= G18), S142 (= S140), Y155 (= Y153), K159 (= K157)
- binding 1-phenylethanone: A93 (≠ N93), N95 (≠ V95), Y155 (= Y153), Y189 (≠ L185)
- binding nicotinamide-adenine-dinucleotide: G13 (= G14), L16 (≠ S17), I18 (= I19), D37 (≠ K42), H61 (≠ A61), D62 (≠ N62), S63 (≠ V63), N89 (≠ A89), A90 (= A90), I92 (≠ M92), M140 (≠ I138), Y155 (= Y153), G188 (= G184), I190 (≠ T186), L194 (≠ M190)
1zjzA Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and NAD (see paper)
37% identity, 96% coverage: 2:244/253 of query aligns to 1:250/251 of 1zjzA
- active site: G17 (= G18), S142 (= S140), Y155 (= Y153), K159 (= K157)
- binding nicotinamide-adenine-dinucleotide: G13 (= G14), L16 (≠ S17), I18 (= I19), D37 (≠ K42), D62 (≠ N62), N89 (≠ A89), A90 (= A90), G91 (= G91), I92 (≠ M92), Y155 (= Y153), G188 (= G184), I190 (≠ T186), L194 (≠ M190)
- binding (1r)-1-phenylethanol: A93 (≠ N93), N95 (≠ V95), L152 (≠ H150), Y155 (= Y153)
1zjyA Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and nadh (see paper)
37% identity, 96% coverage: 2:244/253 of query aligns to 1:250/251 of 1zjyA
- active site: G17 (= G18), S142 (= S140), Y155 (= Y153), K159 (= K157)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G13 (= G14), L16 (≠ S17), G17 (= G18), I18 (= I19), D37 (≠ K42), D62 (≠ N62), N89 (≠ A89), A90 (= A90), G91 (= G91), I92 (≠ M92), Y155 (= Y153), G188 (= G184), I190 (≠ T186), L194 (≠ M190)
- binding (1r)-1-phenylethanol: A93 (≠ N93), N95 (≠ V95), L152 (≠ H150), Y155 (= Y153), Y189 (≠ L185)
Query Sequence
>SMa0329 FitnessBrowser__Smeli:SMa0329
MSKRFDGKVAIVTGGGSGIGAAIANRLLEEGASVMMSGRTEKRLSDVASKMPADRSGIFV
ANVSSRPDCDALVAATVERFGRIDTVVNAAGMNFVGTIQETSDQDWDECIASDLSGVFYM
SRAAVPHLKETKGSIVNIGSVSSLGGGWSHAAYNAAKGGVANLTRSAACDLGKFGVRANT
VAPGLTVTGMVEAIMDDDALLEKAWDRIPLRRAGQPASAVAFLASDEAAWITGIVLPVDG
GQTCTDGGPEWGK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory