SitesBLAST
Comparing SMa0335 FitnessBrowser__Smeli:SMa0335 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7do7A Crystal structure of azotobacter vinelandii l-rhamnose 1- dehydrogenase(NAD and l-rhamnose bound-form) (see paper)
41% identity, 97% coverage: 5:255/258 of query aligns to 1:252/256 of 7do7A
- active site: G16 (= G20), S146 (= S149), Y159 (= Y162)
- binding nicotinamide-adenine-dinucleotide: G12 (= G16), R15 (≠ S19), G16 (= G20), I17 (= I21), S37 (≠ D41), D66 (= D70), A67 (≠ V71), N93 (= N96), A94 (= A97), G95 (= G98), I96 (= I99), V144 (≠ M147), S145 (≠ A148), S146 (= S149), Y159 (= Y162), K163 (= K166), P189 (= P192), G190 (= G193), I192 (= I195), T194 (= T197), I196 (≠ L199)
- binding beta-L-rhamnopyranose: F99 (≠ K102), S146 (= S149), S148 (≠ G151), Q156 (≠ T159), Y159 (= Y162), N197 (≠ L200), D235 (= D238), M236 (≠ L239), R238 (≠ S241)
7b81A Crystal structure of azotobacter vinelandii l-rhamnose 1-dehydrogenase (NAD bound-form) (see paper)
41% identity, 97% coverage: 5:255/258 of query aligns to 1:252/256 of 7b81A
- active site: G16 (= G20), S146 (= S149), Y159 (= Y162)
- binding nicotinamide-adenine-dinucleotide: G12 (= G16), S14 (= S18), R15 (≠ S19), I17 (= I21), D66 (= D70), A67 (≠ V71), N93 (= N96), A94 (= A97), G95 (= G98), I96 (= I99), T116 (≠ V119), V144 (≠ M147), S146 (= S149), Y159 (= Y162), K163 (= K166), P189 (= P192), G190 (= G193), I192 (= I195), T194 (= T197), I196 (≠ L199)
7do6A Crystal structure of azotobacter vinelandii l-rhamnose 1- dehydrogenase(NADP bound-form) (see paper)
42% identity, 97% coverage: 5:255/258 of query aligns to 1:243/247 of 7do6A
- active site: G16 (= G20), S146 (= S149), Y159 (= Y162)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G16), S14 (= S18), R15 (≠ S19), G16 (= G20), I17 (= I21), H36 (≠ S40), S37 (≠ D41), G42 (≠ P46), D66 (= D70), A67 (≠ V71), N93 (= N96), A94 (= A97), G95 (= G98), I96 (= I99), T116 (≠ V119), S146 (= S149), Y159 (= Y162), K163 (= K166), I192 (= I195)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
41% identity, 98% coverage: 6:257/258 of query aligns to 2:248/248 of 6ixmC
- active site: G16 (= G20), S142 (= S149), Y155 (= Y162), K159 (= K166)
- binding nicotinamide-adenine-dinucleotide: G12 (= G16), S15 (= S19), G16 (= G20), I17 (= I21), D36 (= D41), I37 (≠ V42), A61 (= A69), D62 (= D70), T63 (≠ V71), N89 (= N96), A90 (= A97), M140 (= M147), S142 (= S149), Y155 (= Y162), K159 (= K166), P185 (= P192), A186 (≠ G193), Y187 (≠ T194), I188 (= I195), L192 (= L199)
4urfB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
40% identity, 97% coverage: 6:256/258 of query aligns to 2:247/248 of 4urfB
- active site: G16 (= G20), S142 (= S149), I152 (= I158), Y155 (= Y162), K159 (= K166)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: L210 (= L219), R211 (= R220), R212 (= R221)
- binding bicarbonate ion: I92 (= I99), G94 (≠ L101), R109 (= R115), R179 (= R186), S228 (= S237)
- binding nicotinamide-adenine-dinucleotide: G12 (= G16), G14 (≠ S18), N15 (≠ S19), G16 (= G20), I17 (= I21), D36 (= D41), I37 (≠ V42), D62 (= D70), T63 (≠ V71), N89 (= N96), A90 (= A97), G91 (= G98), I140 (≠ M147), Y155 (= Y162), K159 (= K166), P185 (= P192), A186 (≠ G193), I188 (= I195), T190 (= T197)
4urfA Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
40% identity, 97% coverage: 6:256/258 of query aligns to 2:247/248 of 4urfA
- active site: G16 (= G20), S142 (= S149), I152 (= I158), Y155 (= Y162), K159 (= K166)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: I92 (= I99), S93 (≠ T100), G94 (≠ L101), E95 (≠ K102), T97 (= T103), E101 (= E107), T103 (≠ P109), Q106 (≠ D112), R109 (= R115), S175 (≠ P182), G177 (= G184)
- binding magnesium ion: S237 (≠ T246), Y238 (≠ A247)
- binding nicotinamide-adenine-dinucleotide: G12 (= G16), G14 (≠ S18), N15 (≠ S19), G16 (= G20), I17 (= I21), D36 (= D41), I37 (≠ V42), W41 (≠ G49), D62 (= D70), T63 (≠ V71), N89 (= N96), A90 (= A97), G91 (= G98), I140 (≠ M147), Y155 (= Y162), K159 (= K166), P185 (= P192), I188 (= I195), T190 (= T197)
4ureB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
40% identity, 97% coverage: 6:256/258 of query aligns to 2:247/248 of 4ureB
- active site: G16 (= G20), S142 (= S149), I152 (= I158), Y155 (= Y162), K159 (= K166)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: N15 (≠ S19), G16 (= G20), I17 (= I21), N89 (= N96), G91 (= G98), Y155 (= Y162), P185 (= P192), A186 (≠ G193)
1g6kA Crystal structure of glucose dehydrogenase mutant e96a complexed with NAD+
34% identity, 96% coverage: 7:254/258 of query aligns to 5:250/261 of 1g6kA
- active site: G18 (= G20), S145 (= S149), Y158 (= Y162), K162 (= K166)
- binding nicotinamide-adenine-dinucleotide: T17 (≠ S19), G18 (= G20), L19 (≠ I21), R39 (≠ E44), D65 (= D70), V66 (= V71), N92 (= N96), A93 (= A97), G94 (= G98), M143 (= M147), S145 (= S149), Y158 (= Y162), P188 (= P192), G189 (= G193), I191 (= I195), T193 (= T197)
P40288 Glucose 1-dehydrogenase; EC 1.1.1.47 from Priestia megaterium (Bacillus megaterium) (see 2 papers)
34% identity, 96% coverage: 7:254/258 of query aligns to 5:250/261 of P40288
- 11:35 (vs. 13:37, 48% identical) binding
- E96 (≠ T100) mutation E->A,G,K: Heat stable.
- D108 (= D112) mutation to N: Heat stable.
- V112 (≠ L116) mutation to A: Heat stable.
- E133 (≠ A137) mutation to K: Heat stable.
- V183 (= V187) mutation to I: Heat stable.
- P194 (≠ E198) mutation to Q: Heat stable.
- E210 (≠ R214) mutation to K: Heat stable.
- Y217 (≠ R221) mutation to H: Heat stable.
Sites not aligning to the query:
- 252 Q→L: Heat stable.
- 253 Y→C: Heat stable.
- 258 A→G: Heat stable.
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
39% identity, 97% coverage: 7:255/258 of query aligns to 3:246/247 of 4jroC
- active site: G16 (= G20), S142 (= S149), Q152 (≠ T159), Y155 (= Y162), K159 (= K166)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G16), S14 (= S18), R15 (≠ S19), G16 (= G20), I17 (= I21), N35 (≠ D41), Y36 (≠ V42), N37 (≠ V43), G38 (≠ E44), S39 (≠ A45), N63 (≠ D70), V64 (= V71), N90 (= N96), A91 (= A97), I93 (= I99), I113 (≠ V119), S142 (= S149), Y155 (= Y162), K159 (= K166), P185 (= P192), I188 (= I195), T190 (= T197)
3ay6B Crystal structure of bacillus megaterium glucose dehydrogenase 4 a258f mutant in complex with nadh and d-glucose (see paper)
34% identity, 96% coverage: 7:254/258 of query aligns to 11:256/267 of 3ay6B
- active site: G24 (= G20), S151 (= S149), Y164 (= Y162), K168 (= K166)
- binding beta-D-glucopyranose: E102 (≠ T100), S151 (= S149), H153 (≠ G151), W158 (≠ A156), Y164 (= Y162), N202 (≠ L200), K205 (≠ S203)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G20 (= G16), T23 (≠ S19), G24 (= G20), L25 (≠ I21), Y45 (≠ D41), D71 (= D70), V72 (= V71), N98 (= N96), A99 (= A97), G100 (= G98), V101 (≠ I99), M149 (= M147), S151 (= S149), Y164 (= Y162), K168 (= K166), P194 (= P192), G195 (= G193), M197 (≠ I195), T199 (= T197), P200 (≠ E198), I201 (≠ L199), N202 (≠ L200)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
36% identity, 97% coverage: 7:256/258 of query aligns to 5:254/255 of 5itvA
- active site: G18 (= G20), S141 (= S149), Y154 (= Y162), K158 (= K166)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G16), S17 (= S19), G18 (= G20), I19 (= I21), D38 (= D41), I39 (≠ V42), T61 (≠ A69), I63 (≠ V71), N89 (= N96), G91 (= G98), T139 (≠ M147), S141 (= S149), Y154 (= Y162), K158 (= K166), P184 (= P192), G185 (= G193), I186 (≠ T194), I187 (= I195)
5t5qC Crystal structure of short-chain dehydrogenase/reductase sdr:glucose/ribitol dehydrogenase from brucella melitensis
38% identity, 96% coverage: 7:254/258 of query aligns to 5:242/245 of 5t5qC
- active site: G18 (= G20), S140 (= S149), N150 (≠ T159), Y153 (= Y162), K157 (= K166)
- binding nicotinamide-adenine-dinucleotide: N16 (≠ S18), G17 (≠ S19), G18 (= G20), I19 (= I21), D38 (≠ E44), L39 (≠ A45), D63 (= D70), A64 (≠ V71), S90 (≠ N96), I113 (≠ V119), Y153 (= Y162), K157 (= K166), P182 (= P192), I185 (= I195), T187 (= T197), M189 (vs. gap)
6y0sAAA R-specific alcohol dehydrogenase (see paper)
38% identity, 98% coverage: 4:256/258 of query aligns to 1:250/251 of 6y0sAAA
1zk4A Structure of r-specific alcohol dehydrogenase (wildtype) from lactobacillus brevis in complex with acetophenone and NADP (see paper)
38% identity, 98% coverage: 4:256/258 of query aligns to 1:250/251 of 1zk4A
- active site: G17 (= G20), S142 (= S149), Y155 (= Y162), K159 (= K166)
- binding 1-phenylethanone: A93 (≠ T100), Y155 (= Y162), Y189 (≠ T194)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G16), T15 (≠ S18), L16 (≠ S19), I18 (= I21), T36 (≠ V39), G37 (vs. gap), R38 (vs. gap), H61 (≠ A69), D62 (= D70), N89 (= N96), A90 (= A97), G91 (= G98), I92 (= I99), Y155 (= Y162), G188 (= G193), I190 (= I195), T192 (= T197), L194 (= L199)
1zk1A Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and NAD (see paper)
38% identity, 98% coverage: 4:256/258 of query aligns to 1:250/251 of 1zk1A
- active site: G17 (= G20), S142 (= S149), Y155 (= Y162), K159 (= K166)
- binding 1-phenylethanone: A93 (≠ T100), N95 (≠ K102), Y155 (= Y162), Y189 (≠ T194)
- binding nicotinamide-adenine-dinucleotide: G13 (= G16), L16 (≠ S19), I18 (= I21), D37 (vs. gap), H61 (≠ A69), D62 (= D70), S63 (≠ V71), N89 (= N96), A90 (= A97), I92 (= I99), M140 (= M147), Y155 (= Y162), G188 (= G193), I190 (= I195), L194 (= L199)
1zjzA Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and NAD (see paper)
38% identity, 98% coverage: 4:256/258 of query aligns to 1:250/251 of 1zjzA
- active site: G17 (= G20), S142 (= S149), Y155 (= Y162), K159 (= K166)
- binding nicotinamide-adenine-dinucleotide: G13 (= G16), L16 (≠ S19), I18 (= I21), D37 (vs. gap), D62 (= D70), N89 (= N96), A90 (= A97), G91 (= G98), I92 (= I99), Y155 (= Y162), G188 (= G193), I190 (= I195), L194 (= L199)
- binding (1r)-1-phenylethanol: A93 (≠ T100), N95 (≠ K102), L152 (≠ T159), Y155 (= Y162)
1zjyA Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and nadh (see paper)
38% identity, 98% coverage: 4:256/258 of query aligns to 1:250/251 of 1zjyA
- active site: G17 (= G20), S142 (= S149), Y155 (= Y162), K159 (= K166)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G13 (= G16), L16 (≠ S19), G17 (= G20), I18 (= I21), D37 (vs. gap), D62 (= D70), N89 (= N96), A90 (= A97), G91 (= G98), I92 (= I99), Y155 (= Y162), G188 (= G193), I190 (= I195), L194 (= L199)
- binding (1r)-1-phenylethanol: A93 (≠ T100), N95 (≠ K102), L152 (≠ T159), Y155 (= Y162), Y189 (≠ T194)
7ejiB Crystal structure of kred f147l/l153q/y190p/l199a/m205f/m206f variant and methyl methacrylate complex
39% identity, 97% coverage: 7:256/258 of query aligns to 4:250/251 of 7ejiB
- binding methyl 2-methylprop-2-enoate: S142 (= S149), I143 (≠ M150), Y155 (= Y162), F205 (= F213)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G16), T15 (≠ S18), L16 (≠ S19), G17 (= G20), I18 (= I21), R38 (≠ D41), H39 (≠ V42), D62 (= D70), A63 (≠ V71), N89 (= N96), A90 (= A97), V112 (= V119), M140 (= M147), S142 (= S149), Y155 (= Y162), K159 (= K166), P187 (= P192), P189 (≠ T194), I190 (= I195), T192 (= T197), P193 (≠ E198), L194 (= L199)
7ejhA Crystal structure of kred mutant-f147l/l153q/y190p/l199a/m205f/m206f and 2-hydroxyisoindoline-1,3-dione complex
39% identity, 97% coverage: 7:256/258 of query aligns to 6:252/253 of 7ejhA
- binding 2-oxidanylisoindole-1,3-dione: S144 (= S149), I145 (≠ M150), E146 (≠ G151), Y157 (= Y162), V197 (≠ L200), F207 (= F213)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G16), T17 (≠ S18), I20 (= I21), R40 (≠ D41), H41 (≠ V42), D64 (= D70), A65 (≠ V71), N91 (= N96), A92 (= A97), V114 (= V119), M142 (= M147), S144 (= S149), Y157 (= Y162), K161 (= K166), P189 (= P192), G190 (= G193), P191 (≠ T194), I192 (= I195), T194 (= T197), P195 (≠ E198), L196 (= L199)
Query Sequence
>SMa0335 FitnessBrowser__Smeli:SMa0335
MSTSNILDGKVVIVTGASSGIGRAIAIRAAEHGAKAVIVSDVVEAPREGGEPTASEIRKL
GAESVFVKADVSRKVDNDALVAAAEEFGGVDVMVANAGITLKTDGAEVPEDDYRRLMSVN
LDGPLFGAQAAARQMKALNKQGSIVLMASMGGISGAGITVAYSTSKGGVVLMAKSLADAL
GPDGIRVNAVAPGTIDTELLRTSPGIAQASEGFRQRTPLRRLGKPAEVGDAVAFLGSDLS
SYVSGTALLVDGGLLAVI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory