SitesBLAST
Comparing SMa0404 FitnessBrowser__Smeli:SMa0404 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P20932 (S)-mandelate dehydrogenase; MDH; L(+)-mandelate dehydrogenase; EC 1.1.99.31 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 3 papers)
40% identity, 97% coverage: 3:370/381 of query aligns to 5:367/393 of P20932
- PTG 79:81 (≠ PVG 77:79) binding
- G81 (= G79) mutation to A: 23-fold decrease in catalytic activity with mandelate as substrate and DCPIP as electron acceptor, but no change in affinity for mandelate. Shows a modestly higher reactivity with molecular oxygen.
- S108 (= S106) binding
- Q129 (= Q127) binding
- T156 (= T155) binding
- K250 (= K251) binding
- DSGFR 303:307 (≠ DGGIR 306:310) binding
- GR 326:327 (= GR 329:330) binding
6bfgA Crystal structure of monotopic membrane protein (s)-mandelate dehydrogenase (see paper)
40% identity, 97% coverage: 3:370/381 of query aligns to 3:365/373 of 6bfgA
- active site: Y129 (= Y129), D156 (= D157), H272 (= H275)
- binding flavin mononucleotide: Y24 (= Y24), P77 (= P77), T78 (≠ V78), G79 (= G79), Q127 (= Q127), Y129 (= Y129), T154 (= T155), K248 (= K251), H272 (= H275), G273 (= G276), R275 (= R278), D301 (= D306), S302 (≠ G307), G303 (= G308), R305 (= R310), G324 (= G329), R325 (= R330)
1huvA Crystal structure of a soluble mutant of the membrane-associated (s)- mandelate dehydrogenase from pseudomonas putida at 2.15a resolution (see paper)
39% identity, 97% coverage: 3:370/381 of query aligns to 2:341/349 of 1huvA
- active site: S105 (= S106), Y128 (= Y129), T153 (= T155), D155 (= D157), K224 (= K251), H248 (= H275)
- binding flavin mononucleotide: Y23 (= Y24), P76 (= P77), T77 (≠ V78), G78 (= G79), S105 (= S106), Q126 (= Q127), Y128 (= Y129), T153 (= T155), K224 (= K251), H248 (= H275), G249 (= G276), R251 (= R278), D277 (= D306), S278 (≠ G307), G279 (= G308), R281 (= R310), G300 (= G329), R301 (= R330)
2a85A Crystal structure of the g81a mutant of the active chimera of (s)- mandelate dehydrogenase in complex with its substrate 2- hydroxyoctanoate (see paper)
38% identity, 97% coverage: 3:370/381 of query aligns to 2:345/353 of 2a85A
- active site: S105 (= S106), Y128 (= Y129), T153 (= T155), D155 (= D157), K228 (= K251), H252 (= H275)
- binding flavin mononucleotide: Y23 (= Y24), P76 (= P77), T77 (≠ V78), A78 (≠ G79), S105 (= S106), Q126 (= Q127), Y128 (= Y129), T153 (= T155), K228 (= K251), H252 (= H275), G253 (= G276), R255 (= R278), D281 (= D306), S282 (≠ G307), G283 (= G308), R285 (= R310), G304 (= G329), R305 (= R330)
- binding (2s)-2-hydroxyoctanoic acid: Y128 (= Y129), N159 (≠ T161), G160 (= G162), R162 (= R164), H252 (= H275), R255 (= R278)
2a7pA Crystal structure of the g81a mutant of the active chimera of (s)- mandelate dehydrogenase in complex with its substrate 3-indolelactate (see paper)
38% identity, 97% coverage: 3:370/381 of query aligns to 2:345/353 of 2a7pA
- active site: S105 (= S106), Y128 (= Y129), T153 (= T155), D155 (= D157), K228 (= K251), H252 (= H275)
- binding 3-(indol-3-yl) lactate: Y128 (= Y129), R162 (= R164), H252 (= H275)
- binding flavin mononucleotide: Y23 (= Y24), P76 (= P77), T77 (≠ V78), A78 (≠ G79), S105 (= S106), Q126 (= Q127), Y128 (= Y129), T153 (= T155), K228 (= K251), H252 (= H275), G253 (= G276), R255 (= R278), D281 (= D306), S282 (≠ G307), G283 (= G308), R285 (= R310), G304 (= G329), R305 (= R330)
6gmcA 1.2 a resolution structure of human hydroxyacid oxidase 1 bound with fmn and 4-carboxy-5-[(4-chlorophenyl)sulfanyl]-1,2,3-thiadiazole
36% identity, 96% coverage: 3:368/381 of query aligns to 5:351/360 of 6gmcA
- active site: Y132 (= Y129), D160 (= D157), H258 (= H275)
- binding 5-[(4-chlorophenyl)sulfanyl]-1,2,3-thiadiazole-4-carboxylate: Y26 (= Y24), M82 (≠ F80), W110 (≠ F108), Y132 (= Y129), R167 (= R164), F191 (≠ L188), L203 (≠ Q220), Y206 (≠ N223), H258 (= H275), R261 (= R278)
- binding flavin mononucleotide: Y26 (= Y24), Y27 (≠ I25), A79 (≠ P77), T80 (≠ V78), A81 (≠ G79), S108 (= S106), Q130 (= Q127), Y132 (= Y129), T158 (= T155), K234 (= K251), H258 (= H275), G259 (= G276), R261 (= R278), D289 (= D306), G290 (= G307), R293 (= R310), G312 (= G329), R313 (= R330)
5zbmB Structure of glycolate oxidase containing fmn from nicotiana benthamiana (see paper)
35% identity, 97% coverage: 3:370/381 of query aligns to 2:343/353 of 5zbmB
- active site: Y128 (= Y129), D156 (= D157), H248 (= H275)
- binding flavin mononucleotide: Y23 (= Y24), Y24 (≠ I25), P76 (= P77), T77 (≠ V78), W107 (≠ F108), Q126 (= Q127), Y128 (= Y129), T154 (= T155), K224 (= K251), H248 (= H275), G249 (= G276), R251 (= R278), D279 (= D306), G280 (= G307), R283 (= R310), G302 (= G329), R303 (= R330)
1al7A Three-dimensional structures of glycolate oxidase with bound active- site inhibitors (see paper)
35% identity, 97% coverage: 1:370/381 of query aligns to 1:340/350 of 1al7A
- active site: S106 (= S106), Y129 (= Y129), T155 (= T155), D157 (= D157), K221 (= K251), H245 (= H275)
- binding flavin mononucleotide: Y24 (= Y24), Y25 (≠ I25), P77 (= P77), T78 (≠ V78), A79 (≠ G79), S106 (= S106), Q127 (= Q127), T155 (= T155), K221 (= K251), H245 (= H275), R248 (= R278), D276 (= D306), G277 (= G307), R280 (= R310), G299 (= G329), R300 (= R330)
- binding 4-carboxy-5-(1-pentyl)hexylsulfanyl-1,2,3-triazole: Y24 (= Y24), W108 (≠ F108), Y129 (= Y129), R164 (= R164), F172 (= F172), I198 (= I228), H245 (= H275), R248 (= R278)
P05414 Glycolate oxidase; GAO; GOX; Short chain alpha-hydroxy acid oxidase; EC 1.1.3.15 from Spinacia oleracea (Spinach) (see 4 papers)
33% identity, 97% coverage: 1:370/381 of query aligns to 1:349/369 of P05414
- M1 (= M1) modified: N-acetylmethionine
- Y24 (= Y24) mutation to F: 10-fold decrease in affinity for glycolate.
- PTA 77:79 (≠ PVG 77:79) binding
- S106 (= S106) binding
- W108 (≠ F108) mutation to S: 100-fold decrease in affinity for glycolate and 500-fold decrease in activity.
- QLY 127:129 (= QLY 127:129) binding
- T155 (= T155) binding
- K230 (= K251) binding
- S252 (= S273) binding
- DGGVR 285:289 (≠ DGGIR 306:310) binding
- GR 308:309 (= GR 329:330) binding
7r4nA Structure of human hydroxyacid oxidase 1 bound with 5-bromo-n-methyl- 1h-indazole-3-carboxamide
35% identity, 96% coverage: 3:368/381 of query aligns to 4:343/352 of 7r4nA
- binding 5-bromanyl-N-methyl-1H-indazole-3-carboxamide: Y25 (= Y24), A80 (≠ G79), M81 (≠ F80), W109 (≠ F108), Y131 (= Y129), R166 (= R164), M182 (≠ P180), H250 (= H275), R253 (= R278)
- binding flavin mononucleotide: Y25 (= Y24), Y26 (≠ I25), A78 (≠ P77), T79 (≠ V78), A80 (≠ G79), S107 (= S106), W109 (≠ F108), Q129 (= Q127), Y131 (= Y129), T157 (= T155), K226 (= K251), H250 (= H275), G251 (= G276), R253 (= R278), D281 (= D306), G282 (= G307), R285 (= R310), G304 (= G329), R305 (= R330)
5qieA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z2856434894
36% identity, 96% coverage: 3:368/381 of query aligns to 2:344/353 of 5qieA
- active site: Y129 (= Y129), D157 (= D157), H251 (= H275)
- binding flavin mononucleotide: Y23 (= Y24), Y24 (≠ I25), A76 (≠ P77), T77 (≠ V78), A78 (≠ G79), S105 (= S106), Q127 (= Q127), Y129 (= Y129), K227 (= K251), H251 (= H275), G252 (= G276), R254 (= R278), D282 (= D306), G283 (= G307), R286 (= R310), G305 (= G329), R306 (= R330)
- binding ~{N},~{N}-dimethyl-4-[(propan-2-ylamino)methyl]aniline: I3 (≠ V4), D322 (≠ E346)
Q9UJM8 2-Hydroxyacid oxidase 1; HAOX1; Glycolate oxidase; GO; GOX; Glyoxylate oxidase; EC 1.1.3.15; EC 1.2.3.5 from Homo sapiens (Human) (see 2 papers)
35% identity, 96% coverage: 3:368/381 of query aligns to 5:353/370 of Q9UJM8
2rduA Crystal structure of human glycolate oxidase in complex with glyoxylate (see paper)
35% identity, 96% coverage: 3:368/381 of query aligns to 3:351/360 of 2rduA
- active site: S106 (= S106), Y130 (= Y129), T156 (= T155), D158 (= D157), K234 (= K251), H258 (= H275)
- binding flavin mononucleotide: Y24 (= Y24), Y25 (≠ I25), A77 (≠ P77), T78 (≠ V78), A79 (≠ G79), S106 (= S106), Q128 (= Q127), Y130 (= Y129), T156 (= T155), K234 (= K251), H258 (= H275), G259 (= G276), R261 (= R278), D289 (= D306), G290 (= G307), G291 (= G308), R293 (= R310), G312 (= G329), R313 (= R330)
- binding glyoxylic acid: Y24 (= Y24), W108 (≠ F108), Y130 (= Y129), R165 (= R164), H258 (= H275), R261 (= R278)
5qigA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z1407672867
35% identity, 96% coverage: 3:368/381 of query aligns to 2:350/359 of 5qigA
- active site: Y129 (= Y129), D157 (= D157), H257 (= H275)
- binding flavin mononucleotide: Y23 (= Y24), Y24 (≠ I25), A76 (≠ P77), T77 (≠ V78), A78 (≠ G79), S105 (= S106), Q127 (= Q127), Y129 (= Y129), T155 (= T155), K233 (= K251), H257 (= H275), G258 (= G276), R260 (= R278), D288 (= D306), G289 (= G307), G290 (= G308), R292 (= R310), G311 (= G329), R312 (= R330)
- binding 2-cyclopropyl-1~{H}-imidazole-4-carboxamide: L2 (= L3), R223 (= R241), G248 (= G266), F320 (≠ A338), K324 (≠ A342), D328 (≠ E346)
5qifA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z31792168
35% identity, 96% coverage: 3:368/381 of query aligns to 2:350/359 of 5qifA
- active site: Y129 (= Y129), D157 (= D157), H257 (= H275)
- binding flavin mononucleotide: Y23 (= Y24), Y24 (≠ I25), A76 (≠ P77), T77 (≠ V78), A78 (≠ G79), S105 (= S106), Q127 (= Q127), Y129 (= Y129), K233 (= K251), H257 (= H275), G258 (= G276), R260 (= R278), D288 (= D306), G289 (= G307), R292 (= R310), G311 (= G329), R312 (= R330)
- binding 2-cyclohexyl-~{N}-pyridin-3-yl-ethanamide: R223 (= R241), R224 (≠ E242), S227 (≠ A245)
2rdwA Crystal structure of human glycolate oxidase in complex with sulfate (see paper)
35% identity, 96% coverage: 3:368/381 of query aligns to 2:350/359 of 2rdwA
- active site: S105 (= S106), Y129 (= Y129), T155 (= T155), D157 (= D157), K233 (= K251), H257 (= H275)
- binding flavin mononucleotide: Y23 (= Y24), Y24 (≠ I25), A76 (≠ P77), T77 (≠ V78), A78 (≠ G79), Q127 (= Q127), Y129 (= Y129), T155 (= T155), K233 (= K251), H257 (= H275), G258 (= G276), R260 (= R278), D288 (= D306), G289 (= G307), R292 (= R310), G311 (= G329), R312 (= R330)
- binding sulfate ion: Y23 (= Y24), W107 (≠ F108), R164 (= R164), H257 (= H275), R260 (= R278)
6gmbA Structure of human hydroxyacid oxidase 1 bound with fmn and glycolate
35% identity, 96% coverage: 3:368/381 of query aligns to 5:353/362 of 6gmbA
- active site: Y132 (= Y129), D160 (= D157), H260 (= H275)
- binding flavin mononucleotide: Y26 (= Y24), Y27 (≠ I25), A79 (≠ P77), T80 (≠ V78), A81 (≠ G79), S108 (= S106), Q130 (= Q127), Y132 (= Y129), K236 (= K251), H260 (= H275), G261 (= G276), R263 (= R278), D291 (= D306), G292 (= G307), G293 (= G308), R295 (= R310), G314 (= G329), R315 (= R330)
- binding glycolic acid: Y26 (= Y24), W110 (≠ F108), Y132 (= Y129), R167 (= R164), H260 (= H275), R263 (= R278)
5qihA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z2697514548
36% identity, 96% coverage: 3:368/381 of query aligns to 2:335/344 of 5qihA
- active site: Y129 (= Y129), D157 (= D157), H242 (= H275)
- binding flavin mononucleotide: Y23 (= Y24), Y24 (≠ I25), A76 (≠ P77), T77 (≠ V78), A78 (≠ G79), S105 (= S106), Q127 (= Q127), Y129 (= Y129), K218 (= K251), H242 (= H275), G243 (= G276), R245 (= R278), D273 (= D306), G274 (= G307), R277 (= R310), G296 (= G329), R297 (= R330)
- binding 1-methylindazole-3-carboxamide: Y23 (= Y24), A78 (≠ G79), M79 (≠ F80), W107 (≠ F108), Y129 (= Y129), M180 (≠ L188), L187 (≠ A217), H242 (= H275)
5qidA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z1787627869
36% identity, 96% coverage: 3:368/381 of query aligns to 2:335/344 of 5qidA
- active site: Y129 (= Y129), D157 (= D157), H242 (= H275)
- binding flavin mononucleotide: Y23 (= Y24), Y24 (≠ I25), A76 (≠ P77), T77 (≠ V78), A78 (≠ G79), S105 (= S106), Q127 (= Q127), Y129 (= Y129), K218 (= K251), H242 (= H275), G243 (= G276), R245 (= R278), D273 (= D306), G274 (= G307), R277 (= R310), G296 (= G329), R297 (= R330)
- binding 5-chloranyl-~{N}-methyl-~{N}-[[(3~{S})-oxolan-3-yl]methyl]pyrimidin-4-amine: T57 (≠ Q58), E320 (≠ R353), R323 (≠ S356)
5qicA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z30620520
36% identity, 96% coverage: 3:368/381 of query aligns to 2:335/344 of 5qicA
- active site: Y129 (= Y129), D157 (= D157), H242 (= H275)
- binding flavin mononucleotide: Y23 (= Y24), Y24 (≠ I25), A76 (≠ P77), T77 (≠ V78), A78 (≠ G79), S105 (= S106), Q127 (= Q127), Y129 (= Y129), K218 (= K251), H242 (= H275), G243 (= G276), R245 (= R278), D273 (= D306), G274 (= G307), R277 (= R310), G296 (= G329), R297 (= R330)
- binding cyclopropyl-[4-(4-fluorophenyl)piperazin-1-yl]methanone: Y131 (≠ L131), K132 (≠ E132), V136 (≠ L136), M180 (≠ L188), F183 (= F213), Y190 (≠ N223), K193 (≠ R226), A194 (≠ R227)
Query Sequence
>SMa0404 FitnessBrowser__Smeli:SMa0404
MALVNIDDFRDLARRRRPKIFFDYIDGGSFEEETMRANRSDFSRLTLRQNVLVEPQPQDL
ATAYLGKRHPLPFMLGPVGFLGLYSGKGEVKAVRAAHAAGIPFCLSTFSIASLADLRIVT
DGPLHFQLYVLEDRSLCEEFLRAAEYAGVDTLFVTVDTAITGIRERDVRNGFRSLTRVTP
DLFARLALKPRWLAEVVLAGMPSVRAVEHRPEFGRGALEQAANLSRRIDKTLSWKDIAWL
RERWAGKLVIKGVLTPADAVRARDLGCDGVVVSNHGGRQLDGAPSTIRALPSIRATVGTD
FCLMLDGGIRRGADVIKAIALGADGVMLGRAYAYGLSAAGQAGVAEVIAILEREISISLA
LMGIASVEQLKALGAEAVSTL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory