Comparing SMa0495 FitnessBrowser__Smeli:SMa0495 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P02911 Lysine/arginine/ornithine-binding periplasmic protein; LAO-binding protein from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
33% identity, 97% coverage: 4:267/272 of query aligns to 1:260/260 of P02911
5owfA Structure of a lao-binding protein mutant with glutamine (see paper)
33% identity, 88% coverage: 29:267/272 of query aligns to 2:235/235 of 5owfA
1lstA Three-dimensional structures of the periplasmic lysine-, arginine-, ornithine-binding protein with and without a ligand (see paper)
33% identity, 88% coverage: 29:267/272 of query aligns to 5:238/238 of 1lstA
1lahE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
33% identity, 88% coverage: 29:267/272 of query aligns to 5:238/238 of 1lahE
1lagE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
33% identity, 88% coverage: 29:267/272 of query aligns to 5:238/238 of 1lagE
1lafE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
33% identity, 88% coverage: 29:267/272 of query aligns to 5:238/238 of 1lafE
P0AEU0 Histidine-binding periplasmic protein; HBP from Escherichia coli (strain K12) (see 3 papers)
34% identity, 87% coverage: 30:265/272 of query aligns to 28:258/260 of P0AEU0
Sites not aligning to the query:
1hslA Refined 1.89 angstroms structure of the histidine-binding protein complexed with histidine and its relationship with many other active transport(slash)chemosensory receptors (see paper)
34% identity, 87% coverage: 30:265/272 of query aligns to 6:236/238 of 1hslA
P02910 Histidine-binding periplasmic protein; HBP from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
34% identity, 87% coverage: 30:265/272 of query aligns to 28:258/260 of P02910
Sites not aligning to the query:
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
35% identity, 82% coverage: 29:250/272 of query aligns to 5:213/225 of 4zv2A
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
35% identity, 82% coverage: 29:250/272 of query aligns to 5:215/226 of 4zv1A
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
32% identity, 82% coverage: 29:250/272 of query aligns to 11:218/229 of 5t0wA
2y7iA Structural basis for high arginine specificity in salmonella typhimurium periplasmic binding protein stm4351. (see paper)
30% identity, 82% coverage: 23:246/272 of query aligns to 1:213/228 of 2y7iA
8hqrA Crystal structure of the arginine-/lysine-binding protein sar11_1210 from 'candidatus pelagibacter ubique' htcc1062 bound to arginine
31% identity, 88% coverage: 25:262/272 of query aligns to 5:263/267 of 8hqrA
5orgA Structure of the periplasmic binding protein (pbp) occj from a. Tumefaciens b6 in complex with octopine. (see paper)
31% identity, 87% coverage: 29:264/272 of query aligns to 5:254/257 of 5orgA
3tqlA Structure of the amino acid abc transporter, periplasmic amino acid- binding protein from coxiella burnetii. (see paper)
33% identity, 76% coverage: 27:232/272 of query aligns to 1:197/225 of 3tqlA
5ovzA High resolution structure of the pbp noct in complex with nopaline (see paper)
27% identity, 87% coverage: 29:265/272 of query aligns to 4:259/259 of 5ovzA
5otcA Structure of the periplasmic binding protein (pbp) noct from agrobacterium tumefaciens c58 in complex with noroctopinic acid. (see paper)
27% identity, 86% coverage: 29:262/272 of query aligns to 3:250/256 of 5otcA
5otaA Structure of the periplasmic binding protein (pbp) noct from agrobacterium tumefaciens c58 in complex with octopinic acid (see paper)
27% identity, 86% coverage: 29:262/272 of query aligns to 3:250/254 of 5otaA
2ylnA Crystal structure of the l-cystine solute receptor of neisseria gonorrhoeae in the closed conformation (see paper)
31% identity, 86% coverage: 26:260/272 of query aligns to 12:233/240 of 2ylnA
>SMa0495 FitnessBrowser__Smeli:SMa0495
MNAMKNWQTSLTGLITAVLLSAAPANADTLRVGMECTYAPFNYRTSDGKLEGYDVDVAKG
ISEIIGVDFEYVCQEWDGMIPALLANKFDLIIASMSITDKRKEQIDFSSPYRNSVGRIVG
PVGKDLKLFDDKGQPVVGNFDGLRIGVERASTYFEWFSAKLPKADLVLYDSNEAMYLDLK
NGRVDVIMTNPMKAHLSFLSGEGKGKYEFIGPEVNEPKFFGPGVGVGLRKGNDELRDKIS
AAIRKLIREGKLKEYALKIFPFQIHDDAWAEE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory