Comparing SMa0508 FitnessBrowser__Smeli:SMa0508 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3c4jA Abc protein artp in complex with atp-gamma-s
54% identity, 98% coverage: 1:238/243 of query aligns to 1:238/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
54% identity, 98% coverage: 1:238/243 of query aligns to 1:238/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
54% identity, 98% coverage: 1:238/243 of query aligns to 1:238/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
54% identity, 98% coverage: 1:238/243 of query aligns to 1:238/242 of 2oljA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
55% identity, 97% coverage: 3:238/243 of query aligns to 1:236/240 of 4ymuJ
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
53% identity, 98% coverage: 3:239/243 of query aligns to 2:237/241 of 4u00A
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
51% identity, 95% coverage: 8:238/243 of query aligns to 7:249/258 of 1b0uA
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
51% identity, 95% coverage: 8:238/243 of query aligns to 11:253/258 of P02915
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
42% identity, 96% coverage: 8:240/243 of query aligns to 6:243/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
41% identity, 96% coverage: 8:240/243 of query aligns to 7:244/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
41% identity, 96% coverage: 8:240/243 of query aligns to 7:244/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
41% identity, 96% coverage: 8:240/243 of query aligns to 7:244/344 of 3tuiC
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
40% identity, 92% coverage: 9:231/243 of query aligns to 23:241/378 of P69874
Sites not aligning to the query:
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
36% identity, 93% coverage: 1:225/243 of query aligns to 1:226/230 of 6z4wA
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
43% identity, 90% coverage: 7:224/243 of query aligns to 8:229/648 of P75831
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
37% identity, 89% coverage: 9:225/243 of query aligns to 10:226/229 of 6z67B
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
42% identity, 87% coverage: 3:214/243 of query aligns to 3:214/223 of 2pclA
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
37% identity, 94% coverage: 1:229/243 of query aligns to 1:225/369 of P19566
Sites not aligning to the query:
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
40% identity, 88% coverage: 7:219/243 of query aligns to 5:226/232 of 1f3oA
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
36% identity, 96% coverage: 1:234/243 of query aligns to 1:238/615 of 5lilA
>SMa0508 FitnessBrowser__Smeli:SMa0508
MSVVVAKNIRKSFGGLQVLKGVSLTVEGGEVVALIGGSGSGKSTFLRCLNGLESVDSGEI
EVAGHRMSRKPAELRRLRRDVGIVFQSYNLFPHLTAGENIMLAPVQVKGIGKDAARSEAK
RCLSLVGLGDRFEAYPDMLSGGQQQRVAIARSLAMQPKVLLFDEVTSALDPELTGEVLAV
IEKLARDGMTMILVTHEMGFARRVANRTIFMRDGIIHEEGPSAEFFSSPKTPELRAFLHA
EVG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory