SitesBLAST
Comparing SMa0563 FitnessBrowser__Smeli:SMa0563 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q3L181 Perakine reductase; EC 1.1.1.317 from Rauvolfia serpentina (Serpentine wood) (Ophioxylon serpentinum) (see paper)
45% identity, 93% coverage: 1:305/329 of query aligns to 1:305/337 of Q3L181
- D52 (= D50) mutation to A: 99% loss of activity.
- Y57 (= Y55) mutation to A: 99% loss of activity.
- K84 (= K80) mutation to A: Total loss of activity.
- H126 (= H125) mutation to A: 98% loss of activity.
3v0sA Crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during NADPH binding (see paper)
42% identity, 93% coverage: 1:305/329 of query aligns to 1:273/287 of 3v0sA
- active site: D45 (= D50), Y50 (= Y55), G87 (= G93), H119 (= H125)
- binding 2'-monophosphoadenosine-5'-diphosphate: S198 (= S204), P199 (= P205), I200 (≠ L206), G201 (= G207), L204 (≠ F210), P246 (≠ F278), G247 (= G279), T248 (= T280), T249 (≠ R281), N253 (≠ R285), N256 (≠ E288), N257 (= N289)
P46336 Aldo-keto reductase IolS; AKR11A; Vegetative protein 147; VEG147; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
32% identity, 93% coverage: 1:306/329 of query aligns to 1:306/310 of P46336
8hnqA The structure of a alcohol dehydrogenase akr13b2 with NADP
32% identity, 92% coverage: 5:306/329 of query aligns to 18:286/286 of 8hnqA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G31 (= G18), M33 (= M20), R34 (≠ G21), Y71 (= Y55), R138 (= R126), Q187 (= Q175), W214 (≠ F203), A215 (≠ S204), P216 (= P205), L217 (= L206), S219 (≠ K208), G220 (= G209), I257 (≠ L277), P258 (≠ F278), G259 (= G279), T260 (= T280), K262 (= K282), H265 (≠ R285), E268 (= E288), N269 (= N289)
- binding 1,4,7,10,13,16-hexaoxacyclooctadecane: L98 (≠ W83), W106 (≠ G94), R138 (= R126)
Q9P7U2 Putative aryl-alcohol dehydrogenase C977.14c; EC 1.1.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
29% identity, 94% coverage: 7:316/329 of query aligns to 14:349/351 of Q9P7U2
- S113 (= S98) modified: Phosphoserine
1pz0A Structure of NADPH-dependent family 11 aldo-keto reductase akr11a(holo) (see paper)
32% identity, 93% coverage: 2:306/329 of query aligns to 1:305/311 of 1pz0A
- active site: D52 (= D50), Y57 (= Y55), N91 (≠ E91), H124 (= H125)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: H124 (= H125), Q174 (= Q175), Y202 (≠ F203), F203 (≠ S204), P204 (= P205), L205 (= L206), S207 (≠ K208), G208 (= G209), A211 (= A212), K213 (= K214)
O14295 Pyridoxal reductase; PL reductase; PL-red; EC 1.1.1.65 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
29% identity, 96% coverage: 8:323/329 of query aligns to 5:327/333 of O14295
- S292 (≠ E288) modified: Phosphoserine
6ow0A Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
35% identity, 93% coverage: 1:306/329 of query aligns to 1:313/323 of 6ow0A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G18), L21 (≠ M20), D49 (= D50), Y54 (= Y55), S151 (= S155), Y204 (≠ F203), F205 (≠ S204), L207 (= L206), Q209 (≠ K208), G210 (= G209), T213 (≠ A212), K215 (= K214), R227 (= R227), V284 (≠ L277), G286 (= G279), Q292 (≠ R285), N296 (= N289)
6ow0B Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
34% identity, 93% coverage: 1:306/329 of query aligns to 1:289/301 of 6ow0B
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G23), L21 (≠ A25), Y50 (= Y55), H117 (= H125), S147 (= S155), Y200 (≠ F203), F201 (≠ S204), L203 (= L206), Q205 (≠ K208), T209 (≠ A212), Q268 (≠ R285), N272 (= N289)
4aubB The complex structure of the bacterial aldo-keto reductase akr14a1 with NADP and citrate (see paper)
33% identity, 94% coverage: 1:310/329 of query aligns to 11:322/335 of 4aubB
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G29 (= G18), W31 (vs. gap), D59 (= D50), Y64 (= Y55), H136 (= H125), Q191 (= Q175), F220 (= F203), T221 (≠ S204), P222 (= P205), L223 (= L206), Q225 (≠ K208), G226 (= G209), K231 (= K214), R241 (= R227), R244 (≠ I230), L288 (= L277), G290 (= G279), S292 (≠ R281), Q296 (≠ R285), E299 (= E288), N300 (= N289)
Sites not aligning to the query:
P80874 Aldo-keto reductase YhdN; AKR11B; General stress protein 69; GSP69; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
32% identity, 91% coverage: 9:307/329 of query aligns to 10:308/331 of P80874
3n6qD Crystal structure of yghz from e. Coli (see paper)
32% identity, 94% coverage: 1:310/329 of query aligns to 12:309/315 of 3n6qD
1pz1A Structure of NADPH-dependent family 11 aldo-keto reductase akr11b(holo) (see paper)
32% identity, 91% coverage: 9:307/329 of query aligns to 10:308/333 of 1pz1A
- active site: D52 (= D50), Y57 (= Y55), K90 (≠ D86), Q93 (≠ T89), H125 (= H125)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G18), W21 (≠ M20), Q175 (= Q175), Y203 (≠ F203), G204 (≠ S204), L206 (= L206), R208 (≠ K208), K214 (= K214), G280 (= G279), R282 (= R281), Q286 (≠ R285)
8hw0A The structure of akr6d1
31% identity, 89% coverage: 1:294/329 of query aligns to 1:302/329 of 8hw0A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G18), W21 (vs. gap), Q27 (≠ A25), D49 (= D50), Y54 (= Y55), R123 (= R126), S152 (= S155), Q178 (= Q175), W207 (≠ F203), S208 (= S204), P209 (= P205), L210 (= L206), S212 (≠ K208), K218 (= K214), S227 (≠ F226), R228 (= R227), I285 (≠ L277), G287 (= G279), S289 (≠ R281), Q293 (≠ R285), D296 (≠ E288), N297 (= N289)
4aubE The complex structure of the bacterial aldo-keto reductase akr14a1 with NADP and citrate (see paper)
30% identity, 92% coverage: 1:303/329 of query aligns to 12:289/297 of 4aubE
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G30 (= G18), W32 (vs. gap), D60 (= D50), Y65 (= Y55), Q192 (= Q175), F221 (= F203), T222 (≠ S204), P223 (= P205), L224 (= L206), Q226 (≠ K208), T230 (≠ A212), K232 (= K214), L263 (= L277), G265 (= G279), S267 (≠ R281), Q271 (≠ R285), E274 (= E288), N275 (= N289)
Sites not aligning to the query:
4aubF The complex structure of the bacterial aldo-keto reductase akr14a1 with NADP and citrate (see paper)
30% identity, 93% coverage: 1:306/329 of query aligns to 11:295/298 of 4aubF
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G29 (= G18), W31 (vs. gap), D59 (= D50), Y64 (= Y55), H136 (= H125), Q191 (= Q175), F220 (= F203), T221 (≠ S204), P222 (= P205), L223 (= L206), Q225 (≠ K208), L265 (= L277), G267 (= G279), S269 (≠ R281), Q273 (≠ R285), E276 (= E288), N277 (= N289)
1ynqB Aldo-keto reductase akr11c1 from bacillus halodurans (holo form) (see paper)
34% identity, 64% coverage: 1:212/329 of query aligns to 2:206/298 of 1ynqB
- active site: D47 (= D50), Y52 (= Y55), K86 (≠ E91), H120 (= H125)
- binding beta-D-fructofuranose: K4 (= K3), N44 (≠ D47), D71 (≠ K74)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G20 (= G18), C21 (= C19), M22 (= M20), S23 (≠ G21), D47 (= D50), Y52 (= Y55), K77 (= K80), S150 (= S155), M170 (≠ Q175), R197 (≠ F203), G198 (≠ S204), P199 (= P205), V200 (≠ L206), R202 (≠ K208), S206 (≠ A212)
Sites not aligning to the query:
1ynpB Aldo-keto reductase akr11c1 from bacillus halodurans (apo form) (see paper)
34% identity, 64% coverage: 1:212/329 of query aligns to 2:206/298 of 1ynpB
5danA Crystal structure of a novel aldo keto reductase tm1743 from thermotoga maritima in complex with NADP+
27% identity, 93% coverage: 1:307/329 of query aligns to 1:272/274 of 5danA
- active site: D53 (= D50), Y58 (= Y55), K84 (≠ F81), H117 (= H125)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G18), T20 (≠ C19), W21 (≠ M20), D53 (= D50), Y58 (= Y55), H117 (= H125), Q169 (= Q175), Y198 (≠ F203), S199 (= S204), P200 (= P205), L201 (= L206), R203 (≠ K208), Y226 (≠ A260), I242 (≠ L277), P243 (≠ F278), K244 (≠ G279), G246 (≠ R281), R247 (≠ K282), H250 (≠ R285), E253 (= E288), N254 (= N289)
6kiyA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor epalrestat (see paper)
27% identity, 93% coverage: 1:307/329 of query aligns to 2:273/275 of 6kiyA
- binding {5-[(2E)-2-methyl-3-phenylprop-2-en-1-ylidene]-4-oxo-2-thioxo-1,3-thiazolidin-3-yl}acetic acid: W22 (≠ M20), Y59 (= Y55), W87 (= W83), H118 (= H125), R204 (≠ K208)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G18), T21 (≠ C19), W22 (≠ M20), Y59 (= Y55), H118 (= H125), N149 (≠ E156), Q170 (= Q175), Y199 (≠ F203), S200 (= S204), P201 (= P205), L202 (= L206), R204 (≠ K208), T205 (≠ G209), Y227 (≠ A260), I243 (≠ L277), P244 (≠ F278), K245 (≠ G279), G247 (≠ R281), R248 (≠ K282), H251 (≠ R285), E254 (= E288), N255 (= N289)
Query Sequence
>SMa0563 FitnessBrowser__Smeli:SMa0563
MQKRKLGQGLEVSALSLGCMGYGKARDIPDRPQMIELLRRAVDLGMDFFDTAEVYGPWTN
EEMVGEAFAGMRDKVKIATKFGWDIDQSTGEHGGGVNSKPTQIRSAVEGSLKRLRTDFID
LLYQHRVDPDVPMEDVAGTVKDLIAEGKVRYFGLSEAGAESIRRAHAVQPVAALQSEYSL
WTREPEAEIIPTLEELGIGLVPFSPLGKGFLAGKIDASTAFAANDFRSQIPRFAPEAREA
NQALVDLIRSVGERRSATPAQVALAWLMAQKPWIVPLFGTRKLERLEENLGALSVTLSDD
DLEQIESGAAAIRIEGARYPEEMLRRSGR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory