Comparing SMa0710 FitnessBrowser__Smeli:SMa0710 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
P02916 Maltose/maltodextrin transport system permease protein MalF from Escherichia coli (strain K12) (see 4 papers)
33% identity, 72% coverage: 96:336/337 of query aligns to 268:511/514 of P02916
4ki0F Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
33% identity, 69% coverage: 96:326/337 of query aligns to 253:486/490 of 4ki0F
7cagA Mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state (see paper)
29% identity, 81% coverage: 43:316/337 of query aligns to 1:263/285 of 7cagA
P94529 Arabinooligosaccharides transport system permease protein AraP from Bacillus subtilis (strain 168) (see paper)
29% identity, 77% coverage: 55:314/337 of query aligns to 33:288/313 of P94529
>SMa0710 FitnessBrowser__Smeli:SMa0710
MRRPRRFNRRLPPSAHKGKPGAPYVASGPRKKQEAIMSLRFLDLARPSRQHWLGYLLLLP
AVALVALIIVYPLFVSLDLSFQKIGMATLSAPRKPFTLENYHKLFASPDFWNSCWVTIKL
VVVVSAACFAVGLGTALLVNNRFKGRTLARLFVALPWAVPEVIAVVIFAWIFDSSFGLMN
WLFIKLGITSQMINWFSEPTAAFWVVAITMIWKGYPFVSIMTLAGLQSIPEDFYNAAKVD
GANAFQRFWYITIPVLMPVLGVTSVLVVLWVFRDFSIIKVLTDGGPLKATQTLSIMTYDQ
AFGFFNMGYASAIGIVTLVLCVVASLLMLGRKSQAMY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory