Comparing SMa0717 FitnessBrowser__Smeli:SMa0717 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9A9Z1 D-xylonolactone lactonase; Xylono-1,5-lactonase; EC 3.1.1.110 from Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) (see paper)
38% identity, 50% coverage: 281:563/569 of query aligns to 3:282/289 of Q9A9Z1
7pldB Caulobacter crescentus xylonolactonase with (r)-4-hydroxy-2- pyrrolidone (see paper)
38% identity, 50% coverage: 281:563/569 of query aligns to 3:282/289 of 7pldB
7plbB Caulobacter crescentus xylonolactonase with d-xylose (see paper)
38% identity, 50% coverage: 281:563/569 of query aligns to 3:282/289 of 7plbB
4gnaA Mouse smp30/gnl-xylitol complex (see paper)
34% identity, 48% coverage: 283:553/569 of query aligns to 4:280/297 of 4gnaA
4gn9A Mouse smp30/gnl-glucose complex (see paper)
34% identity, 48% coverage: 283:553/569 of query aligns to 4:280/297 of 4gn9A
4gn8A Mouse smp30/gnl-1,5-ag complex (see paper)
34% identity, 48% coverage: 283:553/569 of query aligns to 4:280/297 of 4gn8A
Sites not aligning to the query:
4gn7A Mouse smp30/gnl (see paper)
34% identity, 48% coverage: 283:553/569 of query aligns to 4:280/297 of 4gn7A
5gx1A Luciferin-regenerating enzyme collected with serial synchrotron rotational crystallography with accumulated dose of 1.1 mgy (1st measurement) (see paper)
35% identity, 46% coverage: 293:553/569 of query aligns to 15:290/307 of 5gx1A
5d9bA Luciferin-regenerating enzyme solved by siras using xfel (refined against native data) (see paper)
35% identity, 46% coverage: 293:553/569 of query aligns to 15:290/307 of 5d9bA
Q15493 Regucalcin; RC; Gluconolactonase; GNL; Senescence marker protein 30; SMP-30; EC 3.1.1.17 from Homo sapiens (Human) (see 2 papers)
33% identity, 48% coverage: 283:553/569 of query aligns to 6:282/299 of Q15493
4gncA Human smp30/gnl-1,5-ag complex (see paper)
33% identity, 48% coverage: 283:553/569 of query aligns to 5:281/298 of 4gncA
Sites not aligning to the query:
3g4hA Crystal structure of human senescence marker protein-30 (zinc bound) (see paper)
33% identity, 48% coverage: 283:553/569 of query aligns to 4:280/297 of 3g4hA
P0ACN4 HTH-type transcriptional repressor AllR; Negative regulator of allantoin and glyoxylate utilization operons from Escherichia coli (strain K12) (see paper)
29% identity, 44% coverage: 15:263/569 of query aligns to 17:266/271 of P0ACN4
P16528 Transcriptional repressor IclR; Acetate operon repressor from Escherichia coli (strain K12) (see paper)
27% identity, 43% coverage: 21:265/569 of query aligns to 26:273/274 of P16528
1mkmA Crystal structure of the thermotoga maritima iclr (see paper)
26% identity, 43% coverage: 21:263/569 of query aligns to 3:245/246 of 1mkmA
2o9aA The crystal structure of the e.Coli iclr c-terminal fragment in complex with pyruvate. (see paper)
28% identity, 30% coverage: 95:265/569 of query aligns to 6:179/182 of 2o9aA
2o99C The crystal structure of e.Coli iclr c-terminal fragment in complex with glyoxylate (see paper)
28% identity, 30% coverage: 95:265/569 of query aligns to 6:179/182 of 2o99C
3dr2A Structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways (see paper)
28% identity, 43% coverage: 291:532/569 of query aligns to 41:288/299 of 3dr2A
2xroB Crystal structure of ttgv in complex with its DNA operator (see paper)
30% identity, 38% coverage: 22:238/569 of query aligns to 4:215/240 of 2xroB
Sites not aligning to the query:
5hpiA Crystal structure of the double mutant of pobr transcription factor inducer binding domain-3-hydroxy benzoic acid complex from acinetobacter (see paper)
29% identity, 24% coverage: 104:239/569 of query aligns to 11:151/175 of 5hpiA
>SMa0717 FitnessBrowser__Smeli:SMa0717
MDDKAGLGGLEDRGAPAGAAALAKGLALLDLIAEAPKPLRFADLQKMSGVPKPTLARMLK
TLMVFRLIRQDETTGAYLLGHRFVELSHRVWDKFDLVSAAIPELDRLASELGETVALCRL
DGQRVVYLEERSSGGLGVLIEVGRRVPVHCTAAGKVLLAFQEPSFARSLAGQITYDRFTP
NTITDSQALEADLVLTRARGYAVSYEEHLAGVNSVAAPIAGRDGVPLGALVVLGPASRLD
SSAIHPAGRELMAAARRITGTVGAVAISSGPRPRTRSGGFSDVQCVLPWGAQLGEAPVWV
EREKRLYWVDILHPAVHRFDPVTGKNESCNVAKLVSAVLPTRNEGLIVASQDGVEHFDFD
RGDFNPFAEPEPGLPENRLNDAKVDPSGRLWVGSMRLDVSRPTGSLYRLTSAGEVTRAGS
GFTVANGLAWSPDSSTFYFVDTVPGIIYAYDFDAREGSIANRRVFVTVPEAEGRPDGLAV
DADGGVWCAIWDGWRVNRYRPDGRLDRAVELPVPRPTSVAFGGDELATLFITSARTRLPA
STLTEAPLSGGIFACNPGARGLPTSLFGV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory