Comparing SMa0772 FitnessBrowser__Smeli:SMa0772 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3igjC Crystal structure of maltose o-acetyltransferase complexed with acetyl coenzyme a from bacillus anthracis
51% identity, 98% coverage: 3:181/183 of query aligns to 3:182/188 of 3igjC
4isxA The crystal structure of maltose o-acetyltransferase from clostridium difficile 630 in complex with acetyl-coa
46% identity, 97% coverage: 4:181/183 of query aligns to 3:180/186 of 4isxA
Sites not aligning to the query:
3nz2J Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
46% identity, 99% coverage: 1:181/183 of query aligns to 2:180/185 of 3nz2J
Sites not aligning to the query:
3nz2C Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
46% identity, 97% coverage: 4:181/183 of query aligns to 2:177/183 of 3nz2C
Sites not aligning to the query:
3ectA Crystal structure of the hexapeptide-repeat containing- acetyltransferase vca0836 from vibrio cholerae
46% identity, 96% coverage: 7:181/183 of query aligns to 2:170/176 of 3ectA
5u2kA Crystal structure of galactoside o-acetyltransferase complex with coa (h3 space group)
37% identity, 97% coverage: 4:181/183 of query aligns to 2:180/190 of 5u2kA
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
37% identity, 99% coverage: 1:181/183 of query aligns to 1:181/203 of P07464
Sites not aligning to the query:
1krrA Galactoside acetyltransferase in complex with acetyl-coenzyme a (see paper)
38% identity, 96% coverage: 7:181/183 of query aligns to 6:180/200 of 1krrA
Sites not aligning to the query:
1krvA Galactoside acetyltransferase in complex with coa and pnp-beta-gal (see paper)
38% identity, 96% coverage: 7:181/183 of query aligns to 6:180/201 of 1krvA
Sites not aligning to the query:
1kruA Galactoside acetyltransferase in complex with iptg and coenzyme a (see paper)
38% identity, 96% coverage: 7:181/183 of query aligns to 6:180/201 of 1kruA
Sites not aligning to the query:
4mzuB Crystal structure of fdtd, a bifunctional ketoisomerase/n- acetyltransferase from shewanella denitrificans (see paper)
31% identity, 80% coverage: 37:183/183 of query aligns to 10:141/290 of 4mzuB
Sites not aligning to the query:
4mzuF Crystal structure of fdtd, a bifunctional ketoisomerase/n- acetyltransferase from shewanella denitrificans (see paper)
30% identity, 80% coverage: 37:183/183 of query aligns to 10:142/294 of 4mzuF
Sites not aligning to the query:
A1ADJ6 Polysialic acid O-acetyltransferase; Capsule O-acetyl transferase; EC 2.3.1.136 from Escherichia coli O1:K1 / APEC (see paper)
33% identity, 51% coverage: 89:181/183 of query aligns to 183:276/307 of A1ADJ6
8vr7E Crystal structure of the pcryo_0619 n-acetyltransferase from psychrobacter cryohalolentis k5 int he presence of acetyl coenzyme a
41% identity, 43% coverage: 103:181/183 of query aligns to 90:168/180 of 8vr7E
Sites not aligning to the query:
8vr6A Crystal structure of the pcryo_0619 n-acetryltransferase from psychrobacter cryohalolentis k5 in the presence of coa-disulfide
41% identity, 43% coverage: 103:181/183 of query aligns to 89:167/177 of 8vr6A
8vr7B Crystal structure of the pcryo_0619 n-acetyltransferase from psychrobacter cryohalolentis k5 int he presence of acetyl coenzyme a
41% identity, 43% coverage: 103:181/183 of query aligns to 90:168/177 of 8vr7B
Sites not aligning to the query:
G3XD01 UDP-2-acetamido-3-amino-2,3-dideoxy-D-glucuronate N-acetyltransferase; UDP-D-GlcNAc3NA N-acetyltransferase; UDP-2-acetamido-3-amino-2,3-dideoxy-alpha-D-glucuronic acid 3-N-acetyltransferase; EC 2.3.1.201 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
27% identity, 78% coverage: 38:180/183 of query aligns to 15:150/191 of G3XD01
4eaaA X-ray crystal structure of the h141n mutant of perosamine n- acetyltransferase from caulobacter crescentus in complex with coa and gdp-perosamine (see paper)
31% identity, 82% coverage: 34:183/183 of query aligns to 73:209/210 of 4eaaA
Sites not aligning to the query:
4ea9A X-ray structure of gdp-perosamine n-acetyltransferase in complex with transition state analog at 0.9 angstrom resolution (see paper)
31% identity, 82% coverage: 34:183/183 of query aligns to 71:207/207 of 4ea9A
Sites not aligning to the query:
4ea8A X-ray crystal structure of perb from caulobacter crescentus in complex with coenzyme a and gdp-n-acetylperosamine at 1 angstrom resolution (see paper)
31% identity, 82% coverage: 34:183/183 of query aligns to 71:207/207 of 4ea8A
Sites not aligning to the query:
>SMa0772 FitnessBrowser__Smeli:SMa0772
MTRTQKEKMLAGEMYNAADPEIQADLLAAGAWLKRYNSTLGDSAEQWHLFLREGLGEVGP
GAVIRPPFHCDYGFNISIGAHAYMNFNCVILDVAKVTIGDGTAIGPAVQIYTADHPDDPE
QRQAGLQLGRPVRIGKHVWIGGGAIILPGVTIGDHAVVGAGSVVTRDVPPGAKVMGSPAR
VRG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory