SitesBLAST
Comparing SMa0819 FitnessBrowser__Smeli:SMa0819 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
6fahE Molecular basis of the flavin-based electron-bifurcating caffeyl-coa reductase reaction (see paper)
43% identity, 97% coverage: 1:341/353 of query aligns to 51:390/393 of 6fahE
- binding flavin-adenine dinucleotide: L180 (= L131), R200 (= R150), M281 (≠ L232), G282 (= G233), R307 (= R258), A308 (≠ P259), Q320 (= Q271), V321 (≠ I272), G322 (= G273), Q323 (= Q274), T324 (= T275), G337 (= G288), I338 (= I289), S339 (= S290), Q343 (= Q294), H344 (= H295), N358 (= N309), K359 (≠ T310), L377 (≠ A328)
Sites not aligning to the query:
- binding iron/sulfur cluster: 7, 10, 13, 17, 18, 35, 36, 37, 38, 41, 45, 49
7koeB Electron bifurcating flavoprotein fix/etfabcx (see paper)
46% identity, 93% coverage: 9:336/353 of query aligns to 1:324/336 of 7koeB
- binding flavin-adenine dinucleotide: T121 (= T132), R140 (= R150), T142 (= T152), G219 (= G231), K220 (≠ L232), G221 (= G233), S245 (= S257), R246 (= R258), A247 (≠ P259), Q259 (= Q271), V260 (≠ I272), G261 (= G273), Q262 (= Q274), T263 (= T275), G276 (= G288), S278 (= S290), Q282 (= Q294), H283 (= H295), N297 (= N309), I298 (≠ T310), L316 (≠ A328)
7qh2A Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
38% identity, 92% coverage: 12:335/353 of query aligns to 10:327/337 of 7qh2A
- binding flavin-adenine dinucleotide: L125 (= L131), T126 (= T132), R144 (= R150), I155 (= I161), R224 (≠ L232), G225 (= G233), T249 (≠ S257), R250 (= R258), Q263 (= Q271), I264 (= I272), G265 (= G273), L266 (≠ Q274), S267 (≠ T275), G280 (= G288), I281 (= I289), S282 (= S290), Q286 (= Q294), N301 (= N309), S302 (≠ T310), D303 (= D311), D319 (= D327), L320 (≠ A328)
4kpuA Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
39% identity, 92% coverage: 13:336/353 of query aligns to 11:329/338 of 4kpuA
- binding flavin-adenine dinucleotide: L125 (= L131), R144 (= R150), I155 (= I161), G224 (= G231), R225 (≠ L232), G226 (= G233), S250 (= S257), R251 (= R258), A252 (≠ P259), Q264 (= Q271), V265 (≠ I272), G266 (= G273), Q267 (= Q274), S268 (≠ T275), G281 (= G288), I282 (= I289), S283 (= S290), S285 (≠ A292), Q287 (= Q294), H288 (= H295), N302 (= N309), K303 (≠ T310), D320 (= D327), A321 (= A328)
5ol2A The electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile (see paper)
40% identity, 91% coverage: 14:335/353 of query aligns to 3:320/331 of 5ol2A
- binding calcium ion: E75 (= E90), D188 (≠ E202)
- binding flavin-adenine dinucleotide: T117 (= T132), R136 (= R150), I147 (= I161), G216 (= G231), R217 (≠ L232), G218 (= G233), S242 (= S257), R243 (= R258), A244 (≠ P259), Q256 (= Q271), V257 (≠ I272), G258 (= G273), T260 (= T275), G273 (= G288), I274 (= I289), S275 (= S290), A277 (= A292), Q279 (= Q294), H280 (= H295), N294 (= N309), K295 (≠ T310), D312 (= D327), V313 (≠ A328)
P13804 Electron transfer flavoprotein subunit alpha, mitochondrial; Alpha-ETF from Homo sapiens (Human) (see 6 papers)
35% identity, 70% coverage: 96:342/353 of query aligns to 92:333/333 of P13804
- G116 (= G116) to R: in GA2A; impaired protein stability and loss of electron transfer activity; dbSNP:rs119458971
- T171 (= T180) to I: decreased protein stability; dbSNP:rs1801591
- 205:333 (vs. 214:342, 49% identical) Domain II
- R223 (≠ L232) binding
- S248 (= S257) binding
- R249 (= R258) mutation to A: Loss of electron transfer activity.
- VGQT 263:266 (≠ IGQT 272:275) binding
- T266 (= T275) to M: in GA2A; decreased electron transfer activity; dbSNP:rs119458970
- SGAIQH 281:286 (≠ SGAVQH 290:295) binding
- N300 (= N309) binding
- DL 318:319 (≠ DA 327:328) binding
Sites not aligning to the query:
2a1uA Crystal structure of the human etf e165betaa mutant (see paper)
35% identity, 70% coverage: 96:342/353 of query aligns to 74:315/315 of 2a1uA
- binding flavin-adenine dinucleotide: G204 (= G231), R205 (≠ L232), S230 (= S257), R231 (= R258), A232 (≠ P259), Q244 (= Q271), V245 (≠ I272), G246 (= G273), T248 (= T275), G261 (= G288), I262 (= I289), S263 (= S290), A265 (= A292), Q267 (= Q294), H268 (= H295), N282 (= N309), K283 (≠ T310), D300 (= D327), L301 (≠ A328)
5ow0A Crystal structure of an electron transfer flavoprotein from geobacter metallireducens (see paper)
33% identity, 68% coverage: 95:335/353 of query aligns to 59:287/292 of 5ow0A
- binding flavin-adenine dinucleotide: G183 (= G231), R184 (≠ L232), G185 (= G233), S209 (= S257), R210 (= R258), Q223 (= Q271), I224 (= I272), G225 (= G273), T227 (= T275), G240 (= G288), V241 (≠ I289), S242 (= S290), A244 (= A292), Q246 (= Q294), H247 (= H295), N261 (= N309), K262 (≠ T310), D279 (= D327), Y280 (≠ A328)
1efpA Electron transfer flavoprotein (etf) from paracoccus denitrificans (see paper)
33% identity, 73% coverage: 78:336/353 of query aligns to 58:304/307 of 1efpA
- binding flavin-adenine dinucleotide: G199 (= G231), R200 (≠ L232), G201 (= G233), S225 (= S257), R226 (= R258), A227 (≠ P259), Q239 (= Q271), V240 (≠ I272), G241 (= G273), T243 (= T275), G256 (= G288), I257 (= I289), S258 (= S290), A260 (= A292), Q262 (= Q294), H263 (= H295), N277 (= N309), K278 (≠ T310), D295 (= D327), L296 (≠ A328)
P53571 Electron transfer flavoprotein subunit alpha; Alpha-ETF; Electron transfer flavoprotein large subunit; ETFLS from Methylophilus methylotrophus (Bacterium W3A1) (see 2 papers)
28% identity, 89% coverage: 15:327/353 of query aligns to 4:307/321 of P53571
- R211 (≠ L232) binding
- SR 236:237 (= SR 257:258) binding
- QVGQS 250:254 (≠ QIGQT 271:275) binding
- 268:275 (vs. 288:295, 75% identical) binding
- N289 (= N309) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 307:308 binding
3clrD Crystal structure of the r236a etf mutant from m. Methylotrophus (see paper)
28% identity, 89% coverage: 15:327/353 of query aligns to 3:306/319 of 3clrD
- binding flavin-adenine dinucleotide: G209 (= G231), R210 (≠ L232), G211 (= G233), S235 (= S257), A236 (≠ R258), P237 (= P259), Q249 (= Q271), V250 (≠ I272), G251 (= G273), Q252 (= Q274), S253 (≠ T275), G267 (= G288), I268 (= I289), S269 (= S290), S271 (≠ A292), Q273 (= Q294), H274 (= H295), N288 (= N309), T289 (= T310), D306 (= D327)
Sites not aligning to the query:
Query Sequence
>SMa0819 FitnessBrowser__Smeli:SMa0819
MKKGLPKQFQDYRNVWVFIELEHGQVHPVSIELLGEGRKLADKLGVHLAGVVIGPPGGQG
TANAIADAFAYGADLSYLVESPLLAHYRNEPFTKALTDLVLANKPEILLLGATTLGRDLA
GSVATTLKTGLTADCTELNVDSDGSLAATRPTFGGSLLCTIYTLKCRPQMATVRPSVMAT
PQRVNRPTGSIIRHDLKMLEEEIATKVLAFFSDCDSTIANLAYADVVVAGGLGLGAVQNL
QLLKDLARTLGGDFGCSRPLVQKGWMPFDRQIGQTGNTIRPKLYIAAGISGAVQHRVGVE
GSDLIVAINTDPNAPIFDFAHLGVVADAISFLPALTEVFTKRLEPRNLEKFVQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory