SitesBLAST
Comparing SMa1191 FitnessBrowser__Smeli:SMa1191 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ozwA The crystal structure of flavohemoglobin from r. Eutrophus in complex with ketoconazole (see paper)
81% identity, 100% coverage: 1:403/403 of query aligns to 1:403/403 of 3ozwA
- binding flavin-adenine dinucleotide: A46 (= A46), Q50 (≠ R50), R206 (= R206), Q207 (= Q207), Y208 (= Y208), S209 (= S209), S222 (= S222), V223 (= V223), K224 (= K224), E226 (= E226), P232 (≠ T232), G234 (= G234), Y235 (= Y235), V236 (= V236), S237 (= S237), V276 (= V276), T279 (= T279), V395 (= V395), F396 (= F396)
- binding protoporphyrin ix containing fe: V42 (≠ I42), F43 (= F43), I81 (= I81), H85 (= H85), L88 (= L88), V90 (= V90), Q94 (= Q94), Y95 (= Y95), V98 (= V98), Y126 (= Y126), A130 (= A130), L133 (= L133)
- binding 1-acetyl-4-(4-{[(2R,4S)-2-(2,4-dichlorophenyl)-2-(1H-imidazol-1-ylmethyl)-1,3-dioxolan-4-yl]methoxy}phenyl)piperazine: Q53 (= Q53), A56 (= A56), L102 (= L102), P398 (= P398)
3ozvA The crystal structure of flavohemoglobin from r. Eutrophus in complex with econazole (see paper)
81% identity, 100% coverage: 1:403/403 of query aligns to 1:403/403 of 3ozvA
- binding 1-[(2s)-2-[(4-chlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1h-imidazole: I24 (= I24), F28 (= F28), L57 (= L57), L102 (= L102), I106 (= I106)
- binding flavin-adenine dinucleotide: N44 (= N44), A46 (= A46), Q48 (= Q48), R206 (= R206), Q207 (= Q207), Y208 (= Y208), S209 (= S209), S222 (= S222), V223 (= V223), K224 (= K224), E226 (= E226), P232 (≠ T232), G234 (= G234), Y235 (= Y235), V236 (= V236), S237 (= S237), V276 (= V276), T279 (= T279), F396 (= F396)
- binding protoporphyrin ix containing fe: F43 (= F43), I81 (= I81), K84 (= K84), H85 (= H85), L88 (= L88), V90 (= V90), Q94 (= Q94), Y95 (= Y95), V98 (= V98), Y126 (= Y126), A130 (= A130), L133 (= L133)
3ozuA The crystal structure of flavohemoglobin from r. Eutrophus in complex with miconazole (see paper)
81% identity, 100% coverage: 1:403/403 of query aligns to 1:403/403 of 3ozuA
- binding flavin-adenine dinucleotide: A46 (= A46), H47 (= H47), R206 (= R206), Q207 (= Q207), Y208 (= Y208), S209 (= S209), S222 (= S222), V223 (= V223), K224 (= K224), E226 (= E226), P232 (≠ T232), G234 (= G234), Y235 (= Y235), V236 (= V236), S237 (= S237), E394 (= E394), V395 (= V395), G397 (= G397), P398 (= P398)
- binding protoporphyrin ix containing fe: F43 (= F43), N44 (= N44), I81 (= I81), H85 (= H85), L88 (= L88), V90 (= V90), Q94 (= Q94), Y95 (= Y95), V98 (= V98), Y126 (= Y126), L129 (= L129), A130 (= A130), L133 (= L133)
- binding 1-[(2R)-2-[(2,4-dichlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1H-imidazole: I25 (= I25), F28 (= F28), F43 (= F43), A56 (= A56), L57 (= L57), L102 (= L102), W122 (= W122), A125 (= A125), Y126 (= Y126)
P39662 Flavohemoprotein; FHP; Flavohemoglobin; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) (Ralstonia eutropha) (see paper)
81% identity, 100% coverage: 1:403/403 of query aligns to 1:403/403 of P39662
- A60 (= A60) mutation to Y: Does not affect phospholipid-binding.
- V98 (= V98) mutation to F: Blocks phospholipid-binding.
1cqxA Crystal structure of the flavohemoglobin from alcaligenes eutrophus at 1.75 a resolution (see paper)
80% identity, 100% coverage: 1:403/403 of query aligns to 1:403/403 of 1cqxA
- binding flavin-adenine dinucleotide: A46 (= A46), H47 (= H47), Y190 (= Y190), R206 (= R206), Q207 (= Q207), Y208 (= Y208), S209 (= S209), S222 (= S222), E226 (= E226), Q231 (≠ G231), P232 (≠ T232), G234 (= G234), Y235 (= Y235), V236 (= V236), S237 (= S237), V395 (= V395), G397 (= G397), P398 (= P398)
- binding protoporphyrin ix containing fe: F43 (= F43), N44 (= N44), I81 (= I81), H85 (= H85), L88 (= L88), V90 (= V90), Q94 (= Q94), Y95 (= Y95), V98 (= V98), Y126 (= Y126), L129 (= L129), A130 (= A130), L133 (= L133)
1gvhA The x-ray structure of ferric escherichia coli flavohemoglobin reveals an unespected geometry of the distal heme pocket (see paper)
45% identity, 99% coverage: 1:398/403 of query aligns to 1:392/396 of 1gvhA
- binding flavin-adenine dinucleotide: S46 (≠ A46), Q48 (= Q48), N50 (≠ R50), Y188 (= Y190), R204 (= R206), Q205 (= Q207), Y206 (= Y208), S207 (= S209), A220 (≠ S222), V221 (= V223), E224 (= E226), G227 (= G234), Q228 (≠ Y235), V229 (= V236), S230 (= S237), V269 (= V276), T272 (= T279), E388 (= E394), F390 (= F396)
- binding protoporphyrin ix containing fe: F43 (= F43), Q53 (= Q53), A56 (= A56), L57 (= L57), A60 (= A60), I61 (≠ V61), I81 (= I81), K84 (= K84), H85 (= H85), I90 (≠ V90), Q94 (= Q94), Y95 (= Y95), L127 (= L129), F131 (≠ L133)
Sites not aligning to the query:
P24232 Flavohemoprotein; Flavohemoglobin; HMP; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Escherichia coli (strain K12) (see 2 papers)
45% identity, 99% coverage: 1:398/403 of query aligns to 1:392/396 of P24232
- Y29 (= Y29) mutation Y->E,H: 15 to 35-fold reduction in NO dioxygenase activity.; mutation to F: 30-fold reduction in NO dioxygenase activity, and 80-fold increase in the O(2) dissociation rate constant.
- Y95 (= Y95) active site, Charge relay system
- E135 (= E137) active site, Charge relay system
4g1bA X-ray structure of yeast flavohemoglobin in complex with econazole (see paper)
37% identity, 99% coverage: 1:400/403 of query aligns to 1:394/398 of 4g1bA
- binding 1-[(2s)-2-[(4-chlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1h-imidazole: F28 (= F28), Y29 (= Y29), A56 (= A56), L57 (= L57), T60 (≠ A60), L102 (= L102), Y126 (= Y126)
- binding flavin-adenine dinucleotide: T46 (≠ A46), V50 (≠ R50), K84 (= K84), Y189 (= Y190), R207 (= R206), H208 (≠ Q207), Y209 (= Y208), S210 (= S209), A223 (≠ S222), K225 (= K224), E227 (= E226), F233 (≠ T232), P234 (= P233), G236 (= G234), L237 (≠ Y235), V238 (= V236), S239 (= S237), V282 (= V276), F390 (= F396)
- binding protoporphyrin ix containing fe: I42 (= I42), F43 (= F43), N44 (= N44), N47 (≠ H47), T60 (≠ A60), Q80 (≠ D80), I81 (= I81), K84 (= K84), H85 (= H85), L88 (= L88), I90 (≠ V90), H94 (≠ Q94), Y95 (= Y95), V98 (= V98), F133 (≠ L133), P392 (= P398), K393 (≠ D399), M394 (≠ L400)
Q03331 Flavohemoprotein; Flavohemoglobin; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Candida norvegensis (Yeast) (Candida mycoderma) (see paper)
30% identity, 99% coverage: 2:398/403 of query aligns to 13:385/390 of Q03331
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylserine
4eh1A Crystal structure of the flavohem-like-fad/NAD binding domain of nitric oxide dioxygenase from vibrio cholerae o1 biovar el tor
42% identity, 61% coverage: 155:398/403 of query aligns to 4:237/237 of 4eh1A
- binding flavin-adenine dinucleotide: Y39 (= Y190), R55 (= R206), Q56 (= Q207), Y57 (= Y208), S58 (= S209), S71 (= S222), V72 (= V223), E75 (= E226), N81 (≠ T232), G83 (= G234), L84 (≠ Y235), V85 (= V236), S86 (= S237), T127 (= T279), E233 (= E394), F235 (= F396)
6o0aA Crystal structure of flavohemoglobin from malassezia yamatoensis with bound fad and heme determined by iron sad phasing (see paper)
31% identity, 98% coverage: 2:397/403 of query aligns to 3:383/383 of 6o0aA
- binding flavin-adenine dinucleotide: S48 (≠ A46), R51 (≠ E49), D52 (≠ R50), Y190 (= Y190), R205 (= R206), Q206 (= Q207), F207 (≠ Y208), T208 (≠ S209), K222 (= K224), D224 (≠ G231), H226 (≠ P233), G227 (= G234), E228 (≠ Y235), M229 (≠ V236), T230 (≠ S237), T274 (= T279), E380 (= E394), F382 (= F396), G383 (= G397)
- binding protoporphyrin ix containing fe: M44 (≠ I42), F45 (= F43), S46 (≠ N44), L59 (= L57), S62 (≠ A60), R84 (≠ D80), V85 (≠ I81), H89 (= H85), L92 (= L88), L94 (≠ V90), E98 (≠ Q94), Y99 (= Y95), V102 (= V98), Y130 (= Y126), L133 (= L129)
3tm9A Y29a mutant of vitreoscilla stercoraria hemoglobin (see paper)
50% identity, 36% coverage: 1:146/403 of query aligns to 1:146/146 of 3tm9A
- binding protoporphyrin ix containing fe: L42 (≠ I42), F43 (= F43), Q53 (= Q53), L57 (= L57), T60 (≠ A60), I81 (= I81), K84 (= K84), H85 (= H85), V90 (= V90), Y95 (= Y95), V98 (= V98), Y126 (= Y126), F133 (≠ L133)
4vhbA Thiocyanate adduct of the bacterial hemoglobin from vitreoscilla sp. (see paper)
49% identity, 36% coverage: 1:146/403 of query aligns to 1:138/138 of 4vhbA
- binding protoporphyrin ix containing fe: L42 (≠ I42), F43 (= F43), L49 (= L57), T52 (≠ A60), I73 (= I81), K76 (= K84), H77 (= H85), V82 (= V90), H86 (≠ Q94), Y87 (= Y95), V90 (= V98), F125 (≠ L133)
- binding thiocyanate ion: F28 (= F28), L49 (= L57)
3vhbA Imidazole adduct of the bacterial hemoglobin from vitreoscilla sp. (see paper)
48% identity, 35% coverage: 2:144/403 of query aligns to 1:134/135 of 3vhbA
- binding protoporphyrin ix containing fe: F42 (= F43), L47 (= L57), T50 (≠ A60), I71 (= I81), K74 (= K84), H75 (= H85), V80 (= V90), H84 (≠ Q94), Y85 (= Y95), V88 (= V98), Y116 (= Y126), F123 (≠ L133)
- binding imidazole: Y28 (= Y29), L47 (= L57)
2wy4A Structure of bacterial globin from campylobacter jejuni at 1.35 a resolution (see paper)
42% identity, 35% coverage: 3:143/403 of query aligns to 1:139/139 of 2wy4A
- binding protoporphyrin ix containing fe: M40 (≠ I42), F41 (= F43), N42 (= N44), Q51 (= Q53), L55 (= L57), A58 (= A60), V79 (≠ I81), T82 (≠ K84), H83 (= H85), L86 (= L88), V88 (= V90), H92 (≠ Q94), Y93 (= Y95), V96 (= V98), Y129 (≠ L133)
6wk3D Engineered carbene transferase rmanod q52v, putative nitric oxide dioxygenase from rhodothermus marinus (see paper)
38% identity, 35% coverage: 2:141/403 of query aligns to 6:141/146 of 6wk3D
- binding copper (ii) ion: E51 (= E49), H55 (≠ Q53)
- binding protoporphyrin ix containing fe: L46 (≠ I42), F47 (= F43), L57 (= L57), R80 (≠ D80), M81 (≠ I81), S84 (≠ K84), H85 (= H85), R87 (≠ S87), A88 (≠ L88), V90 (= V90), H94 (≠ Q94), Y95 (= Y95), V98 (= V98), Y126 (= Y126)
7dihA Crystal structure of thermoglobin y29f mutant in complex with imidazole
38% identity, 35% coverage: 1:141/403 of query aligns to 1:136/139 of 7dihA
- binding protoporphyrin ix containing fe: L42 (≠ I42), F43 (= F43), A46 (= A46), S47 (≠ H47), Q50 (= Q53), L54 (= L57), I78 (= I81), S81 (≠ K84), H82 (= H85), V87 (= V90), H91 (≠ Q94), Y92 (= Y95), V95 (= V98), Y121 (= Y126), L124 (= L129)
5ogxA Crystal structure of amycolatopsis cytochrome p450 reductase gcob. (see paper)
31% identity, 53% coverage: 185:398/403 of query aligns to 127:331/333 of 5ogxA
- binding flavin-adenine dinucleotide: Y132 (= Y190), R144 (= R206), Q145 (= Q207), Y146 (= Y208), S147 (= S209), H161 (≠ S222), V162 (= V223), V165 (≠ E226), G168 (= G229), V169 (≠ L230), A170 (≠ G231), T171 (= T232), T214 (≠ V276), F329 (= F396), P331 (= P398)
Sites not aligning to the query:
P0DPQ8 Aromatic O-demethylase, reductase subunit; NADH--hemoprotein reductase; EC 1.6.2.- from Amycolatopsis sp. (strain ATCC 39116 / 75iv2) (see paper)
31% identity, 53% coverage: 185:398/403 of query aligns to 128:332/334 of P0DPQ8
Sites not aligning to the query:
- 35 binding
- 40 binding
- 43 binding
- 75 binding
- 334 binding
2r6hC Crystal structure of the domain comprising the NAD binding and the fad binding regions of the nadh:ubiquinone oxidoreductase, na translocating, f subunit from porphyromonas gingivalis
28% identity, 41% coverage: 233:397/403 of query aligns to 124:289/289 of 2r6hC
Sites not aligning to the query:
Query Sequence
>SMa1191 FitnessBrowser__Smeli:SMa1191
MLTQKTKDIVKATAPVLAQHGYAIIQHFYKRMFQAHPELKNIFNMAHQERGEQQQALARA
VYAYAANIENPESLSAVLKDIAHKHASLGVRPEQYPIVGEHLLASIKEVLGDAATDEIIS
AWAQAYGNLADILAGMESELYERSEERAGGWAGWRRFIVREKNPESDVITSFVLEPADGG
PVADFEPGQYTSVAVQVPKLGYQQIRQYSLSDSPNGRSYRISVKREDGGLGTPGYVSSLL
HDEINVGDELKLAAPYGNFYIDVSATTPIVLISGGVGLTPMVSMLKKALQTPPRKVVFVH
GARNSAVHAMRDRLKEASRTYPDFKLFIFYDEPLPTDIEGRDYDFAGLVDVEKVKDSILL
DDADYYICGPVPFMRMQHDKLLGLGITEARIHYEVFGPDLFAE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory