SitesBLAST
Comparing SMa1296 FitnessBrowser__Smeli:SMa1296 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1lluA The ternary complex of pseudomonas aeruginosa alcohol dehydrogenase with its coenzyme and weak substrate (see paper)
67% identity, 99% coverage: 2:338/340 of query aligns to 5:341/341 of 1lluA
- active site: C43 (= C40), H44 (= H41), T45 (= T42), H48 (= H45), H66 (= H63), E67 (= E64), C97 (= C94), C100 (= C97), C103 (= C100), C111 (= C108), Q115 (= Q112), C153 (= C150), T157 (= T154), R336 (= R333)
- binding 1,2-ethanediol: H44 (= H41), T45 (= T42), L47 (= L44), D53 (= D50), W92 (= W89), C153 (= C150)
- binding nicotinamide-adenine-dinucleotide: C43 (= C40), H44 (= H41), T45 (= T42), H48 (= H45), C153 (= C150), T157 (= T154), G179 (= G176), G180 (= G177), L181 (= L178), D200 (= D197), I201 (= I198), K205 (= K202), A243 (= A240), V244 (= V241), S245 (= S242), A248 (= A245), V265 (= V262), L267 (= L264), I290 (= I287), V291 (= V288), R336 (= R333)
- binding zinc ion: C43 (= C40), H66 (= H63), C100 (= C97), C103 (= C100), C111 (= C108), C153 (= C150)
3s2fE Crystal structure of furx nadh:furfural
64% identity, 99% coverage: 3:339/340 of query aligns to 3:339/340 of 3s2fE
- active site: C40 (= C40), H41 (= H41), T42 (= T42), H45 (= H45), H63 (= H63), E64 (= E64), C94 (= C94), C97 (= C97), C100 (= C100), C108 (= C108), Q112 (= Q112), C150 (= C150), T154 (= T154), R333 (= R333)
- binding furfural: T42 (= T42), W51 (= W51), H63 (= H63), W89 (= W89), C150 (= C150), I287 (= I287)
- binding nicotinamide-adenine-dinucleotide: C40 (= C40), H41 (= H41), T42 (= T42), C150 (= C150), T154 (= T154), G174 (= G174), G176 (= G176), G177 (= G177), L178 (= L178), D197 (= D197), I198 (= I198), K202 (= K202), T239 (= T239), A240 (= A240), V241 (= V241), N262 (≠ V262), G263 (= G263), L264 (= L264), I287 (= I287), V288 (= V288), R333 (= R333)
- binding zinc ion: C40 (= C40), H63 (= H63), C94 (= C94), C97 (= C97), C100 (= C100), C108 (= C108), C150 (= C150)
3s2fA Crystal structure of furx nadh:furfural
64% identity, 99% coverage: 3:339/340 of query aligns to 3:339/340 of 3s2fA
- active site: C40 (= C40), H41 (= H41), T42 (= T42), H45 (= H45), H63 (= H63), E64 (= E64), C94 (= C94), C97 (= C97), C100 (= C100), C108 (= C108), Q112 (= Q112), C150 (= C150), T154 (= T154), R333 (= R333)
- binding phosphorylisopropane: T42 (= T42), H63 (= H63), W89 (= W89), I287 (= I287)
- binding zinc ion: C40 (= C40), H63 (= H63), E64 (= E64), C94 (= C94), C97 (= C97), C100 (= C100), C108 (= C108), C150 (= C150)
3s2eE Crystal structure of furx nadh complex 1
64% identity, 99% coverage: 3:339/340 of query aligns to 3:339/340 of 3s2eE
- active site: C40 (= C40), H41 (= H41), T42 (= T42), H45 (= H45), H63 (= H63), E64 (= E64), C94 (= C94), C97 (= C97), C100 (= C100), C108 (= C108), Q112 (= Q112), C150 (= C150), T154 (= T154), R333 (= R333)
- binding nicotinamide-adenine-dinucleotide: C40 (= C40), H41 (= H41), T42 (= T42), C150 (= C150), T154 (= T154), G176 (= G176), G177 (= G177), L178 (= L178), D197 (= D197), I198 (= I198), K202 (= K202), T239 (= T239), A240 (= A240), V241 (= V241), S242 (= S242), A245 (= A245), N262 (≠ V262), G263 (= G263), L264 (= L264), I287 (= I287), V288 (= V288)
- binding zinc ion: C40 (= C40), H63 (= H63), C94 (= C94), C97 (= C97), C100 (= C100), C108 (= C108), C150 (= C150)
3s2eA Crystal structure of furx nadh complex 1
64% identity, 99% coverage: 3:339/340 of query aligns to 3:339/340 of 3s2eA
- active site: C40 (= C40), H41 (= H41), T42 (= T42), H45 (= H45), H63 (= H63), E64 (= E64), C94 (= C94), C97 (= C97), C100 (= C100), C108 (= C108), Q112 (= Q112), C150 (= C150), T154 (= T154), R333 (= R333)
- binding zinc ion: C40 (= C40), H63 (= H63), E64 (= E64), C94 (= C94), C97 (= C97), C100 (= C100), C108 (= C108), C150 (= C150)
6z42A The low resolution structure of a zinc-dependent alcohol dehydrogenase from halomonas elongata.
66% identity, 99% coverage: 2:338/340 of query aligns to 3:335/336 of 6z42A
- active site: C41 (= C40), T43 (= T42), H46 (= H45), H64 (= H63), C148 (= C150)
- binding zinc ion: C41 (= C40), H64 (= H63), E65 (= E64), C95 (= C94), C98 (= C97), C101 (= C100), C109 (= C108), C148 (= C150)
3meqA Crystal structure of alcohol dehydrogenase from brucella melitensis
63% identity, 99% coverage: 2:338/340 of query aligns to 2:340/341 of 3meqA
- active site: C40 (= C40), H41 (= H41), T42 (= T42), H45 (= H45), H63 (= H63), E64 (= E64), C94 (= C94), C97 (= C97), C100 (= C100), C108 (= C108), L112 (≠ Q112), C150 (= C150), T154 (= T154), R335 (= R333)
- binding 1,4-dihydronicotinamide adenine dinucleotide: C40 (= C40), H41 (= H41), T42 (= T42), H45 (= H45), C150 (= C150), T154 (= T154), G176 (= G176), G177 (= G177), L178 (= L178), D197 (= D197), I198 (= I198), K202 (= K202), T241 (= T239), A242 (= A240), V243 (= V241), S244 (= S242), A247 (= A245), N264 (≠ V262), G265 (= G263), L266 (= L264), I289 (= I287), V290 (= V288)
- binding zinc ion: C40 (= C40), H63 (= H63), C94 (= C94), C97 (= C97), C100 (= C100), C108 (= C108), C150 (= C150)
6n7lC Crystal structure of an alcohol dehydrogenase from elizabethkingia anophelis nuhp1
64% identity, 100% coverage: 2:340/340 of query aligns to 7:344/344 of 6n7lC
- active site: C45 (= C40), T47 (= T42), H50 (= H45), H68 (= H63), C154 (= C150)
- binding nicotinamide-adenine-dinucleotide: C45 (= C40), H46 (= H41), T47 (= T42), H50 (= H45), C154 (= C150), T158 (= T154), G178 (= G174), G180 (= G176), G181 (= G177), L182 (= L178), D201 (= D197), V202 (≠ I198), K206 (= K202), T243 (= T239), A244 (= A240), V245 (= V241), S246 (= S242), A249 (= A245), N266 (≠ V262), G267 (= G263), L268 (= L264), I291 (= I287), V292 (= V288)
- binding zinc ion: C45 (= C40), H68 (= H63), C98 (= C94), C101 (= C97), C104 (= C100), C112 (= C108), C154 (= C150)
Q8GIX7 Alcohol dehydrogenase; ADH; EC 1.1.1.1 from Moraxella sp. (strain TAE123) (see paper)
62% identity, 99% coverage: 3:337/340 of query aligns to 1:335/338 of Q8GIX7
- C38 (= C40) binding
- H61 (= H63) binding
- E62 (= E64) binding
- C92 (= C94) binding
- C95 (= C97) binding
- C98 (= C100) binding
- C106 (= C108) binding
- C148 (= C150) binding
4z6kA Alcohol dehydrogenase from the antarctic psychrophile moraxella sp. Tae 123
62% identity, 99% coverage: 3:337/340 of query aligns to 1:335/345 of 4z6kA
- active site: C38 (= C40), H39 (= H41), T40 (= T42), H43 (= H45), H61 (= H63), E62 (= E64), C92 (= C94), C95 (= C97), C98 (= C100), C106 (= C108), Q110 (= Q112), C148 (= C150), T152 (= T154), R331 (= R333)
- binding zinc ion: C38 (= C40), H61 (= H63), C92 (= C94), C95 (= C97), C98 (= C100), C106 (= C108), C148 (= C150)
P12311 Alcohol dehydrogenase; ADH-T; EC 1.1.1.1 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see paper)
56% identity, 99% coverage: 3:339/340 of query aligns to 1:337/337 of P12311
- C38 (= C40) mutation to S: No activity.
- T40 (= T42) mutation to A: No activity.; mutation to S: Little decrease in activity.
- H43 (= H45) mutation to A: No activity.; mutation to R: Higher level of activity at pH 9.
1rjwA Crystal structure of NAD(+)-dependent alcohol dehydrogenase from bacillus stearothermophilus strain lld-r (see paper)
56% identity, 99% coverage: 3:339/340 of query aligns to 1:337/339 of 1rjwA
- active site: C38 (= C40), H39 (= H41), T40 (= T42), H43 (= H45), H61 (= H63), E62 (= E64), C92 (= C94), C95 (= C97), C98 (= C100), C106 (= C108), K110 (≠ Q112), C148 (= C150), T152 (= T154), R331 (= R333)
- binding trifluoroethanol: T40 (= T42), C148 (= C150), I285 (= I287)
- binding zinc ion: C38 (= C40), H61 (= H63), C92 (= C94), C95 (= C97), C98 (= C100), C106 (= C108)
3piiA Crystal structure of mutant of ht- alcohol dehydrogenase with substrate analogue butyramide
56% identity, 99% coverage: 3:339/340 of query aligns to 1:337/337 of 3piiA
- active site: C38 (= C40), H39 (= H41), T40 (= T42), H43 (= H45), H61 (= H63), E62 (= E64), C92 (= C94), C95 (= C97), C98 (= C100), C106 (= C108), K110 (≠ Q112), C148 (= C150), T152 (= T154), R331 (= R333)
- binding butyramide: T40 (= T42), H61 (= H63), W87 (= W89), C148 (= C150)
- binding zinc ion: C38 (= C40), H61 (= H63), E62 (= E64), C92 (= C94), C95 (= C97), C98 (= C100), C106 (= C108), C148 (= C150)
6iqdA Crystal structure of alcohol dehydrogenase from geobacillus stearothermophilus (see paper)
55% identity, 99% coverage: 3:338/340 of query aligns to 1:336/336 of 6iqdA
- active site: C38 (= C40), T40 (= T42), H43 (= H45), H61 (= H63), C148 (= C150)
- binding zinc ion: C38 (= C40), H61 (= H63), E62 (= E64), C92 (= C94), C95 (= C97), C98 (= C100), C106 (= C108), C148 (= C150)
4eezB Crystal structure of lactococcus lactis alcohol dehydrogenase variant re1 (see paper)
43% identity, 99% coverage: 3:338/340 of query aligns to 1:338/342 of 4eezB
- active site: C39 (= C40), H40 (= H41), T41 (= T42), H44 (= H45), H60 (= H63), E61 (= E64), C91 (= C94), C94 (= C97), C97 (= C100), C105 (= C108), K109 (≠ Q112), C147 (= C150), T151 (= T154), R333 (= R333)
- binding zinc ion: C39 (= C40), H60 (= H63), E61 (= E64), C91 (= C94), C94 (= C97), C97 (= C100), C105 (= C108), C147 (= C150)
P00331 Alcohol dehydrogenase 2; Alcohol dehydrogenase II; ADHII; YADH-2; EC 1.1.1.1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
41% identity, 99% coverage: 2:337/340 of query aligns to 6:345/348 of P00331
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylserine
P00332 Alcohol dehydrogenase; EC 1.1.1.1 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
45% identity, 99% coverage: 5:339/340 of query aligns to 9:349/350 of P00332
- T205 (≠ I198) modified: Phosphothreonine
- T250 (≠ V241) modified: Phosphothreonine
5yatA Crystal structure of mitochondrial alcohol dehydrogenase isozyme iii from komagataella phaffii gs115 (see paper)
42% identity, 99% coverage: 2:337/340 of query aligns to 5:344/347 of 5yatA
- active site: C43 (= C40), T45 (= T42), H48 (= H45), H66 (= H63), C153 (= C150)
- binding zinc ion: C43 (= C40), H66 (= H63), E67 (= E64), C97 (= C94), C100 (= C97), C103 (= C100), C111 (= C108), C153 (= C150)
P00330 Alcohol dehydrogenase 1; Alcohol dehydrogenase I; ADHI; NADH-dependent methylglyoxal reductase; YADH-1; EC 1.1.1.1; EC 1.1.1.54; EC 1.1.1.78 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 6 papers)
40% identity, 99% coverage: 2:339/340 of query aligns to 6:347/348 of P00330
- C44 (= C40) binding
- H45 (= H41) binding ; mutation to R: Decreases dissociation constants by 4-fold for NAD(+) and 2-fold for NADH, while turnover numbers were decreased by 4-fold for ethanol oxidation and 6-fold for acetaldehyde reduction.
- T46 (= T42) binding ; mutation to S: Has the same pattern of activity as the wild-type enzyme for linear primary alcohols.
- H49 (= H45) binding
- W55 (= W51) mutation to M: Has lowered reactivity with primary and secondary alcohols.
- H67 (= H63) binding
- E68 (= E64) binding in the open conformation
- W93 (= W89) mutation to A: Has an inverted specificity pattern for primary alcohols, being 3- and 10-fold more active on hexanol and 350- and 540-fold less active on ethanol. Also acquires weak activity on branched chain alcohols and cyclohexanol.
- C98 (= C94) binding
- C101 (= C97) binding
- C104 (= C100) binding
- C112 (= C108) binding
- C154 (= C150) binding
- G181 (= G176) binding
- G182 (= G177) binding
- L183 (= L178) binding
- D202 (= D197) binding
- K207 (= K202) binding
- F222 (vs. gap) binding
- T236 (= T230) natural variant: T -> I
- V269 (= V262) binding
- M271 (≠ L264) binding ; mutation to L: Produces a 7 to 10-fold increase in reactivity with butanol, pentanol, and hexanol.
- S294 (= S286) binding
- V296 (= V288) binding
- R341 (= R333) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylserine
5envA Yeast alcohol dehydrogenase with bound coenzyme (see paper)
40% identity, 99% coverage: 2:339/340 of query aligns to 5:346/347 of 5envA
- active site: C43 (= C40), H44 (= H41), T45 (= T42), H48 (= H45), H66 (= H63), E67 (= E64), C97 (= C94), C100 (= C97), C103 (= C100), C111 (= C108), D115 (≠ Q112), C153 (= C150), R340 (= R333)
- binding trifluoroethanol: T45 (= T42), W54 (= W51), H66 (= H63), W92 (= W89), C153 (= C150), M270 (≠ L264), Y294 (≠ I287)
- binding nicotinamide-adenine-dinucleotide: H44 (= H41), T45 (= T42), H48 (= H45), T157 (= T154), G177 (= G174), G180 (= G176), G181 (= G177), L182 (= L178), D201 (= D197), K206 (= K202), F221 (vs. gap), S246 (≠ A240), V268 (= V262), G269 (= G263), V295 (= V288)
- binding zinc ion: C43 (= C40), H66 (= H63), C97 (= C94), C100 (= C97), C103 (= C100), C111 (= C108), C153 (= C150)
Query Sequence
>SMa1296 FitnessBrowser__Smeli:SMa1296
MTMTAAVVREFGKPLVIEEVPVPQPGPGQVLIKYEATGVCHTDLHAAKGDWPVRPNPPFI
PGHEGVGYVAKLGAEVTRLKEGDRVGVPWLHTACGCCTPCRTGWETLCGSQQNTGYSVDG
TFAQYGLADPDFVGRLPARLEFGPAAPVLCAGVTVYKGLKETEVRPGEWVLVSGIGGLGH
MAVQYAKAMGMHVAAADIFPDKLALAEKLGADLVVDARAPDAVEEVQRRTGGLHGALVTA
VSPKAMEQAYSMLRSKGTMALVGLPPGQICLPVFDTVLKRITVRGSIVGTRQDLEEALEF
AGEGKVAAHFSWDKIENINAIFERMEEGKIDGRIVLDLNG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory