Comparing SMa1328 SMa1328 MtbA protein to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
21% identity, 47% coverage: 11:217/440 of query aligns to 40:255/583 of Q9Y7Q9
Sites not aligning to the query:
Q496J9 Synaptic vesicle glycoprotein 2C from Homo sapiens (Human) (see 4 papers)
27% identity, 33% coverage: 67:213/440 of query aligns to 203:346/727 of Q496J9
Sites not aligning to the query:
P36035 Carboxylic acid transporter protein homolog from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
25% identity, 35% coverage: 63:216/440 of query aligns to 186:325/616 of P36035
Sites not aligning to the query:
>SMa1328 SMa1328 MtbA protein
MAVQVPTDFRRVIVAASVGNIIEWYDFYIFGSLAAVLSVKFFEQSHPVAALLSTIALFTA
GFLIRPLGAFLFGWMGDRVGRKYTFLITLTGMGLGTGAIGLIPTYESIGLTAAFLLFSLR
MIQGLCLGGEYGGAITYVAEHVPDERRGYYTGWLQTSPTLGIVVSLAVIIAARTYFGSEA
FDAWAWRVPFLVSFLLVGIAIYIRLQLQETPIFQEIKAKGQMTQNPWREAFLSSNIKYVG
IATIVLIGQGVVWYSGQFWALYFLQQVSKVDPLNSAYIVGAALLLATPSLILFGWLSDII
GRKPVILGGMLLAALTYYPLYLWLGAVTQPDNINYPIAIFIIFILVCYVGMVYGPVGAFL
AEYFPGRIRYTSVSVPYHIGNGWGGGLVPFITSAAFAATGSIGYALIYPIAVPAVCFVLA
IFLMPETRRISIWQPIEPRT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory