SitesBLAST
Comparing SMa1351 FitnessBrowser__Smeli:SMa1351 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3bjsB Crystal structure of a member of enolase superfamily from polaromonas sp. Js666
37% identity, 88% coverage: 45:398/402 of query aligns to 29:366/376 of 3bjsB
- active site: P49 (≠ S69), S52 (= S72), L93 (≠ M119), G136 (≠ S168), K164 (= K194), R166 (= R196), D194 (= D227), N196 (≠ H229), E220 (= E253), G246 (= G278), E247 (= E279), N248 (≠ S280), Q268 (= Q300), D270 (= D302), H297 (= H329), S298 (≠ L330), S299 (≠ W331), E322 (= E354), C324 (≠ S356), K327 (≠ A359)
- binding magnesium ion: D194 (= D227), E220 (= E253), E247 (= E279)
Sites not aligning to the query:
3sjnA Crystal structure of enolase spea_3858 (target efi-500646) from shewanella pealeana with magnesium bound
32% identity, 87% coverage: 45:395/402 of query aligns to 26:367/373 of 3sjnA
- active site: S46 (≠ N65), L49 (≠ G68), T139 (≠ S168), K165 (= K194), G167 (≠ R196), M171 (= M200), D198 (= D227), A200 (= A228), E225 (= E253), I247 (= I275), G250 (= G278), E251 (= E279), S252 (= S280), Q272 (= Q300), D274 (= D302), H301 (= H329), G302 (≠ L330), F303 (≠ W331), M325 (≠ V353), E326 (= E354), Q329 (≠ V357), S331 (≠ A359)
- binding magnesium ion: D198 (= D227), E225 (= E253), E251 (= E279)
3ozmA Crystal structure of enolase superfamily member from bordetella bronchiseptica complexed with mg, m-xylarate and l-lyxarate
32% identity, 97% coverage: 14:401/402 of query aligns to 2:375/386 of 3ozmA
- active site: M20 (≠ R32), G53 (= G71), D56 (vs. gap), S143 (= S168), K170 (= K194), K172 (≠ R196), D200 (= D227), N202 (≠ H229), E226 (= E253), G252 (= G278), E253 (= E279), N254 (≠ S280), Q274 (= Q300), D276 (= D302), H303 (= H329), T304 (≠ L330), F305 (≠ W331), E328 (= E354), I331 (≠ V357), H333 (≠ A359)
- binding D-xylaric acid: S24 (= S36), K29 (≠ L41), Y146 (≠ W171), K170 (= K194), K172 (≠ R196), D200 (= D227), N202 (≠ H229), E253 (= E279), H303 (= H329), F305 (≠ W331), E328 (= E354)
- binding magnesium ion: D200 (= D227), E226 (= E253), E253 (= E279)
3ozmD Crystal structure of enolase superfamily member from bordetella bronchiseptica complexed with mg, m-xylarate and l-lyxarate
33% identity, 96% coverage: 14:399/402 of query aligns to 2:373/381 of 3ozmD
- active site: M20 (≠ R32), G53 (= G71), D56 (vs. gap), S143 (= S168), K170 (= K194), K172 (≠ R196), D200 (= D227), N202 (≠ H229), E226 (= E253), G252 (= G278), E253 (= E279), N254 (≠ S280), Q274 (= Q300), D276 (= D302), H303 (= H329), T304 (≠ L330), F305 (≠ W331), E328 (= E354), I331 (≠ V357), H333 (≠ A359)
- binding L-arabinaric acid: K172 (≠ R196), D200 (= D227), N202 (≠ H229), E253 (= E279), H303 (= H329), F305 (≠ W331), E328 (= E354)
- binding magnesium ion: D200 (= D227), E226 (= E253), E253 (= E279)
3op2A Crystal structure of putative mandelate racemase from bordetella bronchiseptica rb50 complexed with 2-oxoglutarate/phosphate
32% identity, 97% coverage: 14:401/402 of query aligns to 2:370/375 of 3op2A
- active site: M20 (≠ R32), G53 (= G71), D56 (vs. gap), S138 (= S168), K165 (= K194), K167 (≠ R196), D195 (= D227), N197 (≠ H229), E221 (= E253), G247 (= G278), E248 (= E279), N249 (≠ S280), Q269 (= Q300), D271 (= D302), H298 (= H329), T299 (≠ L330), F300 (≠ W331), E323 (= E354), I326 (≠ V357), H328 (≠ A359)
- binding 2-oxoglutaric acid: K165 (= K194), K167 (≠ R196), D195 (= D227), E248 (= E279), H298 (= H329), E323 (= E354)
- binding magnesium ion: D195 (= D227), E221 (= E253), E248 (= E279)
4hpnA Crystal structure of a proposed galactarolactone cycloisomerase from agrobacterium tumefaciens, target efi-500704, with bound ca, ordered loops (see paper)
31% identity, 92% coverage: 26:395/402 of query aligns to 1:370/378 of 4hpnA
- active site: F19 (= F44), G50 (= G68), R53 (≠ G71), T134 (≠ S168), K164 (= K194), K166 (≠ R196), D194 (= D227), N196 (≠ H229), E220 (= E253), G245 (= G278), E246 (= E279), T247 (≠ S280), Q267 (= Q300), D269 (= D302), H296 (= H329), V297 (≠ L330), W298 (= W331), R320 (vs. gap), E329 (= E354), F330 (≠ Y355), H334 (≠ A359)
- binding calcium ion: D194 (= D227), D209 (≠ Q242), E220 (= E253), G237 (≠ A270), E246 (= E279)
5olcC Crystal structure of the 3,6-anhydro-d-galactonate cycloisomerase from zobellia galactanivorans (see paper)
32% identity, 89% coverage: 43:401/402 of query aligns to 18:351/351 of 5olcC
- active site: K148 (= K194), K150 (≠ R196), D178 (= D227), N180 (≠ H229), E204 (= E253), G229 (= G278), E230 (= E279), D253 (= D302), H280 (= H329), E304 (= E354), E309 (≠ A359)
- binding magnesium ion: D178 (= D227), E204 (= E253), E230 (= E279)
3stpA Crystal structure of a putative galactonate dehydratase
34% identity, 86% coverage: 50:396/402 of query aligns to 51:384/390 of 3stpA
- active site: L66 (≠ G68), S69 (≠ G71), S151 (= S168), K177 (= K194), R179 (= R196), P189 (= P204), E214 (≠ D227), Y216 (≠ H229), E240 (= E253), G265 (= G278), E266 (= E279), H267 (≠ S280), Q287 (= Q300), D289 (= D302), I311 (≠ L324), H316 (= H329), E336 (= E354), F341 (vs. gap)
- binding magnesium ion: E214 (≠ D227), E240 (= E253), E266 (= E279)
4h19A Crystal structure of an enolase (mandelate racemase subgroup, target efi-502087) from agrobacterium tumefaciens, with bound mg and d- ribonohydroxamate, ordered loop
32% identity, 94% coverage: 14:389/402 of query aligns to 1:358/372 of 4h19A
- active site: I20 (≠ Q33), T51 (≠ N65), T143 (≠ S168), K172 (= K194), K174 (≠ R196), D203 (= D227), N205 (≠ H229), E229 (= E253), G254 (= G278), E255 (= E279), Q276 (= Q300), D278 (= D302), H305 (= H329), A306 (= A332), G307 (= G333), E327 (= E354)
- binding (2R,3R,4R)-N,2,3,4,5-pentakis(oxidanyl)pentanamide: D22 (≠ Q35), H25 (≠ F38), H52 (≠ A66), K172 (= K194), K174 (≠ R196), D203 (= D227), N205 (≠ H229), E229 (= E253), E255 (= E279), H305 (= H329), E327 (= E354)
- binding calcium ion: D268 (≠ V292), H298 (≠ F322)
- binding magnesium ion: D203 (= D227), E229 (= E253), E255 (= E279)
4e6mA Crystal structure of putative dehydratase protein from salmonella enterica subsp. Enterica serovar typhimurium (salmonella typhimurium)
27% identity, 96% coverage: 14:398/402 of query aligns to 2:395/401 of 4e6mA
- active site: L45 (≠ N65), G48 (= G68), K169 (= K194), D171 (≠ R196), I175 (≠ M200), E223 (≠ D227), H225 (= H229), E249 (= E253), G274 (= G278), E275 (= E279), R276 (≠ S280), Q296 (= Q300), D298 (= D302), H325 (= H329), C327 (≠ W331), E350 (= E354), A355 (= A359)
- binding magnesium ion: E223 (≠ D227), E249 (= E253), E275 (= E279)
3rraB Crystal structure of enolase prk14017 (target efi-500653) from ralstonia pickettii 12j with magnesium bound
34% identity, 88% coverage: 40:392/402 of query aligns to 6:349/379 of 3rraB
- active site: I35 (≠ A66), R38 (≠ S69), Y118 (= Y166), K145 (= K194), N147 (vs. gap), E151 (≠ R196), D184 (= D227), H186 (= H229), E210 (= E253), G235 (= G278), E236 (= E279), R237 (≠ S280), Q257 (= Q300), D259 (= D302), H286 (= H329), P288 (≠ W331), E311 (= E354)
- binding magnesium ion: D184 (= D227), E210 (= E253), E236 (= E279)
3sqsA Crystal structure of a putative mandelate racemase/muconate lactonizing protein from dinoroseobacter shibae dfl 12
32% identity, 86% coverage: 50:396/402 of query aligns to 47:380/386 of 3sqsA
- active site: L62 (≠ G68), N65 (≠ G71), S147 (= S168), K173 (= K194), R175 (= R196), G177 (= G198), G179 (vs. gap), K181 (≠ M200), A185 (≠ P204), E210 (≠ D227), Y212 (≠ H229), E236 (= E253), G261 (= G278), E262 (= E279), H263 (≠ S280), Q283 (= Q300), D285 (= D302), I307 (≠ L324), H312 (= H329), G314 (= G333), E332 (= E354), F337 (vs. gap)
- binding magnesium ion: E210 (≠ D227), E236 (= E253), E262 (= E279), Y347 (≠ H364), F350 (≠ V367), D351 (≠ E368)
4h83F Crystal structure of mandelate racemase/muconate lactonizing enzyme (efi target:502127)
29% identity, 91% coverage: 32:398/402 of query aligns to 18:365/368 of 4h83F
- active site: F20 (≠ H34), D51 (≠ N65), I139 (≠ S168), K166 (= K194), K168 (≠ R196), I196 (≠ V226), D197 (= D227), A198 (= A228), N199 (≠ H229), E223 (= E253), G249 (= G278), Q250 (≠ E279), N271 (≠ Q300), D273 (= D302), H300 (= H329), E301 (≠ G333), E302 (≠ A334), E320 (= E354), D325 (≠ G358)
- binding bicarbonate ion: R220 (≠ A250), I318 (≠ V352)
Q6BF17 D-galactonate dehydratase; GalD; EC 4.2.1.6 from Escherichia coli (strain K12)
33% identity, 87% coverage: 48:396/402 of query aligns to 17:359/382 of Q6BF17
- H185 (= H229) mutation H->N,Q: Loss of activity.
- H285 (= H329) mutation to N: Loss of activity.
- E310 (= E354) mutation to Q: Loss of activity.
3no1A Crystal structure of mandelate racemase/muconate lactonizing enzyme from a marine actinobacterium in complex with magnesium
30% identity, 87% coverage: 48:398/402 of query aligns to 22:353/355 of 3no1A
- active site: D39 (≠ N65), I127 (≠ S168), K154 (= K194), K156 (≠ R196), I184 (≠ V226), D185 (= D227), A186 (= A228), N187 (≠ H229), E211 (= E253), G237 (= G278), Q238 (≠ E279), N259 (≠ Q300), D261 (= D302), H288 (= H329), E289 (≠ G333), E290 (≠ A334), E308 (= E354), D313 (≠ G358)
- binding magnesium ion: D185 (= D227), E211 (= E253), Q238 (≠ E279)
3cb3A Crystal structure of l-talarate dehydratase from polaromonas sp. Js666 complexed with mg and l-glucarate
33% identity, 87% coverage: 45:394/402 of query aligns to 35:360/373 of 3cb3A
- active site: S57 (≠ A67), T143 (≠ S168), K171 (= K194), K173 (≠ R196), D202 (= D227), N204 (≠ H229), E228 (= E253), G253 (= G278), E254 (= E279), M275 (≠ Q300), D277 (= D302), H304 (= H329), F305 (≠ L330), A306 (≠ C336), E324 (= E354)
- binding l-glucaric acid: K171 (= K194), K173 (≠ R196), D202 (= D227), E254 (= E279), H304 (= H329)
- binding magnesium ion: D202 (= D227), E228 (= E253), A243 (≠ R268), F246 (≠ G271), E254 (= E279)
Sites not aligning to the query:
2og9A Crystal structure of mandelate racemase/muconate lactonizing enzyme from polaromonas sp. Js666
33% identity, 87% coverage: 45:394/402 of query aligns to 24:349/363 of 2og9A
- active site: S46 (≠ A67), T132 (≠ S168), K160 (= K194), K162 (≠ R196), D191 (= D227), N193 (≠ H229), E217 (= E253), G242 (= G278), E243 (= E279), M264 (≠ Q300), D266 (= D302), H293 (= H329), F294 (≠ L330), A295 (≠ C336), E313 (= E354)
- binding calcium ion: A232 (≠ R268), F235 (≠ G271)
3rcyF Crystal structure of mandelate racemase/muconate lactonizing enzyme- like protein from roseovarius sp. Tm1035
30% identity, 86% coverage: 48:392/402 of query aligns to 25:371/397 of 3rcyF
- active site: K165 (= K194), D167 (vs. gap), R175 (= R196), G208 (≠ D227), H210 (= H229), E234 (= E253), G259 (= G278), E260 (= E279), Q281 (= Q300), A283 (≠ D302), H310 (= H329), A313 (= A332), L332 (≠ F351), E335 (= E354)
- binding magnesium ion: E234 (= E253), E260 (= E279)
- binding alpha-D-ribofuranose: R85 (= R111), P86 (= P120), P239 (≠ A258), A266 (≠ F285), E267 (≠ A286)
3ck5A Crystal structure of a racemase from streptomyces coelicolor a3(2) with bound magnesium
33% identity, 94% coverage: 16:391/402 of query aligns to 2:348/357 of 3ck5A
- active site: T19 (≠ H34), T50 (≠ N65), G137 (= G169), K164 (= K194), K166 (≠ R196), D195 (= D227), N197 (≠ H229), I220 (≠ F252), E221 (= E253), I243 (= I275), G246 (= G278), E247 (= E279), E268 (≠ Q300), D270 (= D302), H297 (= H329), G298 (≠ P335), V299 (≠ C336), Y315 (≠ V352), E317 (= E354)
- binding magnesium ion: D195 (= D227), E221 (= E253), E247 (= E279)
2ox4C Crystal structure of putative dehydratase from zymomonas mobilis zm4
29% identity, 87% coverage: 48:396/402 of query aligns to 24:384/397 of 2ox4C
- active site: K165 (= K194), D167 (≠ R196), E214 (≠ D227), H216 (= H229), E240 (= E253), G265 (= G278), E266 (= E279), Q287 (= Q300), D289 (= D302), H316 (= H329), E341 (= E354)
- binding magnesium ion: E214 (≠ D227), E240 (= E253), E266 (= E279)
Query Sequence
>SMa1351 FitnessBrowser__Smeli:SMa1351
MPCGLRAARLGGEMRIKTVQAWWVRIPIEANRQHQSDFGRLTTFDAAILRIETDDGIVGW
GEGKNAAGSAGSYGTLVHMLNYEVGPRLVGRDAADISAVWEMLYNGVRHERAAMSGHAMP
ELSRRGLSIAAISAVDIALWDILGKSLGVPVWKLLGGRKADRLPAYASGGWESAEKIGGQ
LQSYLASGGFKAVKMRVGAMDGAPYVSAARVRAARKALGPSVDIMVDAHGTYTVADAKRF
IQLVRDCDLAWFEEPVIADDKAGMAEVRAAGNVPIATGESEATRFAFRDLAVLRSADIFQ
PDPAFCGGITEAMRIGAIASAFNLRLAPHLWAGAPCFFSGLHICAASPASFVVEYSVGAN
PMIHDLVEETVAVKDGMLEIPDKPGLGFTINERVLETHAQRL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory