Comparing SMa1353 FitnessBrowser__Smeli:SMa1353 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ytuA Crystal structure of d-tagatose 3-epimerase c66s from pseudomonas cichorii in complex with l-erythrulose (see paper)
32% identity, 78% coverage: 5:234/295 of query aligns to 12:246/294 of 4ytuA
4yttA Crystal structure of d-tagatose 3-epimerase c66s from pseudomonas cichorii in complex with 6-deoxy l-psicose (see paper)
32% identity, 78% coverage: 5:234/295 of query aligns to 12:246/294 of 4yttA
Sites not aligning to the query:
4ytsA Crystal structure of d-tagatose 3-epimerase c66s from pseudomonas cichorii in complex with 1-deoxy 3-keto d-galactitol (see paper)
32% identity, 78% coverage: 5:234/295 of query aligns to 12:246/294 of 4ytsA
Sites not aligning to the query:
4ytrA Crystal structure of d-tagatose 3-epimerase c66s from pseudomonas cichorii in complex with 1-deoxy l-tagatose (see paper)
32% identity, 78% coverage: 5:234/295 of query aligns to 12:246/294 of 4ytrA
Sites not aligning to the query:
4ytqA Crystal structure of d-tagatose 3-epimerase c66s from pseudomonas cichorii in complex with 1-deoxy d-tagatose (see paper)
32% identity, 78% coverage: 5:234/295 of query aligns to 12:246/294 of 4ytqA
Sites not aligning to the query:
4xsmA Crystal structure of d-tagatose 3-epimerase c66s from pseudomonas cichorii in complex with d-talitol (see paper)
32% identity, 78% coverage: 5:234/295 of query aligns to 12:246/294 of 4xsmA
4ytrC Crystal structure of d-tagatose 3-epimerase c66s from pseudomonas cichorii in complex with 1-deoxy l-tagatose (see paper)
33% identity, 77% coverage: 8:234/295 of query aligns to 15:246/297 of 4ytrC
Sites not aligning to the query:
4ytqC Crystal structure of d-tagatose 3-epimerase c66s from pseudomonas cichorii in complex with 1-deoxy d-tagatose (see paper)
33% identity, 77% coverage: 8:234/295 of query aligns to 15:246/297 of 4ytqC
Sites not aligning to the query:
2qumA Crystal structure of d-tagatose 3-epimerase from pseudomonas cichorii with d-tagatose (see paper)
32% identity, 78% coverage: 5:234/295 of query aligns to 12:246/290 of 2qumA
Sites not aligning to the query:
O50580 D-tagatose 3-epimerase; DTE; D-ribulose 3-epimerase; Ketose 3-epimerase; EC 5.1.3.31 from Pseudomonas cichorii (see 2 papers)
32% identity, 78% coverage: 5:234/295 of query aligns to 12:246/290 of O50580
4pfhA Crystal structure of engineered d-tagatose 3-epimerase pcdte-idf8 (see paper)
31% identity, 81% coverage: 8:245/295 of query aligns to 15:254/298 of 4pfhA
Sites not aligning to the query:
4pglA Crystal structure of engineered d-tagatose 3-epimerase pcdte-ils6 (see paper)
31% identity, 81% coverage: 8:245/295 of query aligns to 15:254/298 of 4pglA
Sites not aligning to the query:
7x7wA The x-ray crystallographic structure of d-psicose 3-epimerase from clostridia bacterium
31% identity, 74% coverage: 18:234/295 of query aligns to 22:244/288 of 7x7wA
B8I944 D-psicose 3-epimerase; DPEase; EC 5.1.3.30 from Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) (Clostridium cellulolyticum) (see paper)
30% identity, 74% coverage: 18:234/295 of query aligns to 22:244/293 of B8I944
Sites not aligning to the query:
3vnjA Crystal structures of d-psicose 3-epimerase with d-psicose from clostridium cellulolyticum h10 (see paper)
30% identity, 74% coverage: 18:234/295 of query aligns to 23:245/290 of 3vnjA
Sites not aligning to the query:
3vnmA Crystal structures of d-psicose 3-epimerase with d-sorbose from clostridium cellulolyticum h10 (see paper)
30% identity, 74% coverage: 18:234/295 of query aligns to 22:244/289 of 3vnmA
Sites not aligning to the query:
3vnlA Crystal structures of d-psicose 3-epimerase with d-tagatose from clostridium cellulolyticum h10 (see paper)
30% identity, 74% coverage: 18:234/295 of query aligns to 23:245/291 of 3vnlA
Sites not aligning to the query:
3vnkA Crystal structures of d-psicose 3-epimerase with d-fructose from clostridium cellulolyticum h10 (see paper)
30% identity, 74% coverage: 18:234/295 of query aligns to 22:244/290 of 3vnkA
Sites not aligning to the query:
7cj5A Crystal structure of homo dimeric d-allulose 3-epimerase from methylomonas sp. In complex with d-fructose (see paper)
29% identity, 84% coverage: 25:271/295 of query aligns to 35:287/292 of 7cj5A
Sites not aligning to the query:
A0A172U6X0 L-ribulose 3-epimerase; LRE; MetLRE; EC 5.1.3.31 from Methylomonas sp. (strain DH-1) (see paper)
29% identity, 82% coverage: 25:267/295 of query aligns to 36:283/286 of A0A172U6X0
Sites not aligning to the query:
>SMa1353 FitnessBrowser__Smeli:SMa1353
MHLSTHNWMRAEPLAVTLKRIKKYGYESIEISGEPAQYDIKDTRALLKEHGIRCWGAVTL
TLGERNLAAKDESQRAKSVDYVKSVITMVSELEGEIVTLVPATVGKVVPDGTEEEEWQWV
VDATKECFAHAREKGVRLAIEPLNRFETYLFNRAAQALALADAVDPDCGVCLDAFHLNIE
EEDIYDAIRLAGNRLFDFHVADNNRFAAGLGHLDWPKIVATLKEIGYDGALTNEFVAPVD
RTPAAKYPDMVERNPVDIPPEQLKFIQDHGSSLLTEKFYDDQMRITAETILPLIK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory