Comparing SMa1371 FitnessBrowser__Smeli:SMa1371 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
39% identity, 96% coverage: 3:315/326 of query aligns to 4:317/326 of Q8RDH4
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
40% identity, 91% coverage: 1:298/326 of query aligns to 1:305/330 of P0AAH4
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
39% identity, 96% coverage: 3:315/326 of query aligns to 3:306/310 of 4fwiB
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
37% identity, 79% coverage: 2:257/326 of query aligns to 2:246/253 of 7z15I
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
37% identity, 79% coverage: 2:257/326 of query aligns to 2:246/250 of 7z18I
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
34% identity, 92% coverage: 3:301/326 of query aligns to 1:281/343 of P30750
Sites not aligning to the query:
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
37% identity, 79% coverage: 2:257/326 of query aligns to 2:246/250 of 7z16I
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
34% identity, 92% coverage: 3:301/326 of query aligns to 2:282/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
34% identity, 92% coverage: 3:301/326 of query aligns to 2:282/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
34% identity, 92% coverage: 3:301/326 of query aligns to 2:282/344 of 6cvlD
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
36% identity, 78% coverage: 2:256/326 of query aligns to 1:237/241 of 4u00A
3c4jA Abc protein artp in complex with atp-gamma-s
32% identity, 78% coverage: 1:255/326 of query aligns to 1:238/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
32% identity, 78% coverage: 1:255/326 of query aligns to 1:238/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
32% identity, 78% coverage: 1:255/326 of query aligns to 1:238/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
32% identity, 78% coverage: 1:255/326 of query aligns to 1:238/242 of 2oljA
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
35% identity, 77% coverage: 22:271/326 of query aligns to 19:250/393 of P9WQI3
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
35% identity, 72% coverage: 1:234/326 of query aligns to 1:218/230 of 6z4wA
7arlD Lolcde in complex with lipoprotein and adp (see paper)
37% identity, 66% coverage: 3:217/326 of query aligns to 2:205/222 of 7arlD
7mdyC Lolcde nucleotide-bound
35% identity, 68% coverage: 3:225/326 of query aligns to 2:213/226 of 7mdyC
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
31% identity, 74% coverage: 6:246/326 of query aligns to 6:232/353 of 1oxvD
>SMa1371 FitnessBrowser__Smeli:SMa1371
MPLLEIDNLHVCFDTRAGTVQALRGVSLTVAPGETLGIVGESGSGKSVTAQAVMGLIDVP
GRISDGEILWEGKPLAGFAVANAARDIWGREITMIFQNPMTSLNPLMTVGAQIAEVIEVH
MGSSRRAARRRAAELLSAVGISGAERRLDQYPHEFSGGMRQRVMIAMGIACEPKLLIADE
PTTALDVTIQAQILELLAELQEKMGLAIVLITHDLGIVAGLCHRVAVMYAGQIVETGPVD
AIFENPSHPYTQGLIRSTPGLDADEERLTAIDGAPPGLLQPPSGCAFLPRCPIGDEGCQG
PQVLRAVGAGTVACRKAGEQAWREAV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory