Comparing SMa1440 FitnessBrowser__Smeli:SMa1440 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ur8A Crystal structure of keto-deoxy-d-galactarate dehydratase complexed with 2-oxoadipic acid (see paper)
63% identity, 100% coverage: 1:301/301 of query aligns to 1:301/304 of 4ur8A
5hwnB Crystal structure of keto-deoxy-d-galactarate dehydratase complexed with pyruvate (see paper)
63% identity, 100% coverage: 1:301/301 of query aligns to 1:301/310 of 5hwnB
Q8UGL3 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
34% identity, 72% coverage: 19:235/301 of query aligns to 10:228/294 of Q8UGL3
4i7wA Agrobacterium tumefaciens dhdps with lysine and pyruvate
32% identity, 72% coverage: 19:235/301 of query aligns to 10:228/294 of 4i7wA
7mjfA Crystal structure of candidatus liberibacter solanacearum dihydrodipicolinate synthase with pyruvate and succinic semi-aldehyde bound in active site
28% identity, 90% coverage: 19:288/301 of query aligns to 10:279/296 of 7mjfA
Sites not aligning to the query:
7lvlA Dihydrodipicolinate synthase bound with allosteric inhibitor (s)- lysine from candidatus liberibacter solanacearum
28% identity, 90% coverage: 19:288/301 of query aligns to 10:279/296 of 7lvlA
Q9X1K9 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
28% identity, 91% coverage: 27:299/301 of query aligns to 17:291/294 of Q9X1K9
1o5kA Crystal structure of dihydrodipicolinate synthase (tm1521) from thermotoga maritima at 1.80 a resolution
28% identity, 91% coverage: 27:299/301 of query aligns to 18:292/295 of 1o5kA
Q5HG25 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Staphylococcus aureus (strain COL) (see paper)
28% identity, 91% coverage: 20:293/301 of query aligns to 14:283/295 of Q5HG25
3di1B Crystal structure of the staphylococcus aureus dihydrodipicolinate synthase-pyruvate complex (see paper)
28% identity, 91% coverage: 20:293/301 of query aligns to 14:283/291 of 3di1B
Sites not aligning to the query:
Q07607 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; Protein MosA; EC 4.3.3.7 from Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
30% identity, 91% coverage: 13:285/301 of query aligns to 4:274/292 of Q07607
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
38% identity, 51% coverage: 19:172/301 of query aligns to 10:167/291 of 4dxvA
Sites not aligning to the query:
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
38% identity, 51% coverage: 19:172/301 of query aligns to 10:167/291 of 3u8gA
Sites not aligning to the query:
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
38% identity, 51% coverage: 19:172/301 of query aligns to 10:167/291 of 3tdfA
Sites not aligning to the query:
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
38% identity, 51% coverage: 19:172/301 of query aligns to 10:167/291 of 3tceA
Sites not aligning to the query:
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
38% identity, 51% coverage: 19:172/301 of query aligns to 10:167/291 of 3rk8A
Sites not aligning to the query:
3pueB Crystal structure of the complex of dhydrodipicolinate synthase from acinetobacter baumannii with lysine at 2.6a resolution
38% identity, 51% coverage: 19:172/301 of query aligns to 10:167/291 of 3pueB
Sites not aligning to the query:
4fhaA Structure of dihydrodipicolinate synthase from streptococcus pneumoniae,bound to pyruvate and lysine
30% identity, 93% coverage: 19:297/301 of query aligns to 15:292/307 of 4fhaA
1xxxA Crystal structure of dihydrodipicolinate synthase (dapa, rv2753c) from mycobacterium tuberculosis (see paper)
29% identity, 98% coverage: 5:299/301 of query aligns to 3:292/296 of 1xxxA
P9WP25 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
28% identity, 98% coverage: 5:299/301 of query aligns to 7:296/300 of P9WP25
>SMa1440 FitnessBrowser__Smeli:SMa1440
MSPEEIKSRVGSGLLSFPVTHFTSDYKLNLESYRRHVEWLSGFEAAALFAAGGTGEFFSL
SPNEVGQVTRAAKDVSGEVPIIAGCGYGTSLAVETAKIVEEAGADGILLLPHYLTEAPQE
GIYAHVKAVCDSTGLGVILYNRANSVANADTVARLAEACPNLIGFKDGTGKVDLVRHVTA
KLGDRLCYIGGMPTHELFAEGFNGVGVTTYSSAVFNFVPELAQRFYRAMRAGDRAVMEGI
LHTFFFPFAALRDRKAGYPVSIIKAGVELAGFAPGPVRPPLVDLTGEEREILQGLIEASR
R
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory