SitesBLAST
Comparing SMa1525 FitnessBrowser__Smeli:SMa1525 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4hea1 Crystal structure of the entire respiratory complex i from thermus thermophilus (see paper)
53% identity, 99% coverage: 2:417/421 of query aligns to 12:428/437 of 4hea1
- binding flavin mononucleotide: G63 (= G53), K74 (= K64), N91 (= N81), D93 (= D83), Y179 (= Y169), G182 (= G172), E183 (= E173), N218 (= N208), N219 (= N209), L401 (= L390)
- binding iron/sulfur cluster: I180 (= I170), P198 (= P188), S351 (= S341), C352 (= C342), G353 (= G343), K354 (= K344), C355 (= C345), C358 (= C348), F398 (= F387), C399 (= C388), L401 (= L390)
2ybb1 Fitted model for bovine mitochondrial supercomplex i1iii2iv1 by single particle cryo-em (emd-1876) (see paper)
53% identity, 99% coverage: 2:417/421 of query aligns to 12:428/437 of 2ybb1
- binding flavin mononucleotide: G63 (= G53), G65 (= G55), N91 (= N81), D93 (= D83), G182 (= G172), E183 (= E173), E184 (= E174), N218 (= N208), N219 (= N209), T222 (= T212), P400 (≠ A389)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G65 (= G55), G66 (= G56), F69 (= F59), K74 (= K64), F77 (= F67), E96 (= E86), Y179 (= Y169), E184 (= E174), K201 (= K191), F204 (= F194), T324 (≠ S314)
- binding iron/sulfur cluster: S351 (= S341), C352 (= C342), K354 (= K344), C355 (= C345), C358 (= C348), F398 (= F387), C399 (= C388), L401 (= L390), A402 (≠ G391)
Q56222 NADH-quinone oxidoreductase subunit 1; NADH dehydrogenase I chain 1; NDH-1 subunit 1; EC 7.1.1.- from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
53% identity, 99% coverage: 2:417/421 of query aligns to 13:429/438 of Q56222
8e9hF Mycobacterial respiratory complex i, fully-inserted quinone (see paper)
51% identity, 100% coverage: 2:420/421 of query aligns to 3:427/436 of 8e9hF
- binding flavin mononucleotide: G53 (= G53), R54 (= R54), G55 (= G55), A57 (= A57), K64 (= K64), N90 (= N81), D92 (= D83), Y178 (= Y169), G181 (= G172), E182 (= E173), E183 (= E174), N217 (= N208), N218 (= N209), S221 (≠ T212), L398 (= L390)
- binding iron/sulfur cluster: P197 (= P188), S349 (= S341), C350 (= C342), G351 (= G343), K352 (= K344), C353 (= C345), C356 (= C348), S394 (≠ T386), F395 (= F387), C396 (= C388), L398 (= L390), G399 (= G391)
- binding zinc ion: C333 (= C325), E371 (= E363), H420 (= H412), C425 (= C418)
7p61F Complex i from e. Coli, ddm-purified, with nadh, resting state (see paper)
50% identity, 98% coverage: 4:415/421 of query aligns to 12:425/442 of 7p61F
- binding flavin mononucleotide: G61 (= G53), G63 (= G55), K72 (= K64), N90 (= N81), D92 (= D83), G181 (= G172), E182 (= E173), N217 (= N208), N218 (= N209), A399 (= A389), H400 (≠ L390)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G63 (= G55), G64 (= G56), A65 (= A57), F67 (= F59), K72 (= K64), L75 (≠ F67), E95 (= E86), Y178 (= Y169), E183 (= E174), F203 (= F194), R320 (≠ M311), T323 (≠ S314)
- binding iron/sulfur cluster: S350 (= S341), C351 (= C342), W353 (≠ K344), C354 (= C345), C357 (= C348), F397 (= F387), C398 (= C388), H400 (≠ L390)
7t30B Structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn/NAD(h) bound state (see paper)
49% identity, 99% coverage: 5:419/421 of query aligns to 6:420/425 of 7t30B
- binding fe2/s2 (inorganic) cluster: C326 (= C325), C364 (≠ E363), H413 (= H412), C419 (= C418)
- binding flavin mononucleotide: G54 (= G53), G56 (= G55), K65 (= K64), N82 (= N81), D84 (= D83), E85 (= E84), G173 (= G172), E175 (= E174), N210 (= N209), G390 (≠ A389), L391 (= L390)
- binding nicotinamide-adenine-dinucleotide: G56 (= G55), G57 (= G56), A58 (= A57), F60 (= F59), K65 (= K64), F68 (= F67), E85 (= E84), E175 (= E174), R192 (≠ K191), F195 (= F194), I312 (≠ M311), M313 (≠ L312), S315 (= S314)
- binding iron/sulfur cluster: S342 (= S341), C343 (= C342), G344 (= G343), C346 (= C345), C349 (= C348), S387 (≠ T386), C389 (= C388), L391 (= L390), G392 (= G391)
Sites not aligning to the query:
7t2rB Structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn-free apo state (see paper)
49% identity, 99% coverage: 5:419/421 of query aligns to 6:420/425 of 7t2rB
- binding fe2/s2 (inorganic) cluster: C326 (= C325), D329 (≠ K328), C364 (≠ E363), H413 (= H412), C419 (= C418)
- binding iron/sulfur cluster: P189 (= P188), C343 (= C342), G344 (= G343), C346 (= C345), C349 (= C348), C389 (= C388), G392 (= G391)
Sites not aligning to the query:
8a6tB Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from thermoanaerobacter kivui in the reduced state (see paper)
47% identity, 99% coverage: 5:419/421 of query aligns to 152:565/630 of 8a6tB
- binding flavin mononucleotide: G201 (= G55), N227 (= N81), E230 (= E84), N355 (= N209), G535 (≠ A389), L536 (= L390)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S320 (≠ E174), R337 (≠ K191), R340 (≠ F194), T341 (≠ P195), N342 (≠ A196), S433 (= S287)
- binding iron/sulfur cluster: S487 (= S341), C488 (= C342), G489 (= G343), C491 (= C345), C494 (= C348), C534 (= C388), L536 (= L390), G537 (= G391)
- binding zinc ion: C471 (= C325), H558 (= H412), C564 (= C418)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 31, 33, 36, 82, 85, 86
- binding iron/sulfur cluster: 575, 577, 582, 583, 585, 588, 592, 596, 597, 607, 612, 618, 622, 624, 626, 627
7v2cA Active state complex i from q10 dataset (see paper)
53% identity, 91% coverage: 39:420/421 of query aligns to 48:428/433 of 7v2cA
- binding flavin mononucleotide: G62 (= G53), K73 (= K64), N91 (= N81), Y179 (= Y169), G182 (= G172), E183 (= E173), N219 (= N209), A401 (= A389), L402 (= L390)
- binding iron/sulfur cluster: P198 (= P188), C354 (= C342), G355 (= G343), Q356 (≠ K344), C357 (= C345), C360 (= C348), T398 (= T386), C400 (= C388), L402 (= L390)
8b9zF Drosophila melanogaster complex i in the active state (dm1) (see paper)
51% identity, 91% coverage: 40:421/421 of query aligns to 56:435/441 of 8b9zF
- binding flavin mononucleotide: G69 (= G53), G71 (= G55), K80 (= K64), N98 (= N81), D100 (= D83), G189 (= G172), E191 (= E174), N226 (= N209), A408 (= A389), L409 (= L390)
- binding iron/sulfur cluster: P205 (= P188), C361 (= C342), G362 (= G343), Q363 (≠ K344), C364 (= C345), C367 (= C348), T405 (= T386), C407 (= C388), L409 (= L390)
7dgq8 NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial (see paper)
53% identity, 91% coverage: 39:420/421 of query aligns to 42:422/427 of 7dgq8
- binding flavin mononucleotide: G58 (= G55), K67 (= K64), N85 (= N81), D87 (= D83), E88 (= E84), G89 (= G85), C175 (= C171), G176 (= G172), A212 (≠ N208), N213 (= N209)
- binding iron/sulfur cluster: S347 (= S341), C348 (= C342), G349 (= G343), C351 (= C345), C354 (= C348), C394 (= C388), L396 (= L390)
- binding : R121 (≠ E117), Y132 (≠ V128), Q139 (≠ E135), R143 (≠ A139), Y146 (≠ H142), E147 (= E143), F165 (≠ H161), R168 (= R164)
8eswV1 NADH dehydrogenase (Ubiquinone) 24 kDa subunit, isoform A (see paper)
51% identity, 91% coverage: 40:421/421 of query aligns to 54:433/439 of 8eswV1
- binding flavin mononucleotide: G67 (= G53), G69 (= G55), K78 (= K64), N96 (= N81), D98 (= D83), E99 (= E84), G187 (= G172), E188 (= E173), N224 (= N209), A406 (= A389)
- binding iron/sulfur cluster: I185 (= I170), P203 (= P188), C359 (= C342), Q361 (≠ K344), C362 (= C345), C365 (= C348), T403 (= T386), I404 (≠ F387), C405 (= C388), L407 (= L390)
- binding : Y143 (≠ V128), N144 (≠ T129), Q150 (≠ E135), D174 (≠ M159)
5lnk1 Entire ovine respiratory complex i (see paper)
53% identity, 91% coverage: 39:420/421 of query aligns to 47:427/432 of 5lnk1
- binding fe2/s2 (inorganic) cluster: P96 (= P87), G97 (= G88)
- binding flavin mononucleotide: G61 (= G53), R62 (= R54), K72 (= K64), N90 (= N81), D92 (= D83), E93 (= E84), G94 (= G85), Y178 (= Y169), G181 (= G172), E182 (= E173), V216 (≠ I207), A217 (≠ N208), N218 (= N209), T221 (= T212), L401 (= L390)
- binding iron/sulfur cluster: P197 (= P188), S352 (= S341), C353 (= C342), Q355 (≠ K344), C356 (= C345), C359 (= C348), T397 (= T386), I398 (≠ F387), C399 (= C388)
6zk91 Peripheral domain of open complex i during turnover (see paper)
53% identity, 91% coverage: 39:420/421 of query aligns to 45:425/430 of 6zk91
- binding flavin mononucleotide: G59 (= G53), G61 (= G55), K70 (= K64), N88 (= N81), D90 (= D83), E91 (= E84), G179 (= G172), E180 (= E173), A215 (≠ N208), N216 (= N209), A398 (= A389), L399 (= L390)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G61 (= G55), G62 (= G56), A63 (= A57), F65 (= F59), K70 (= K64), E93 (= E86), Y176 (= Y169), E181 (= E174), F201 (= F194), T323 (≠ S314)
- binding iron/sulfur cluster: I177 (= I170), P195 (= P188), C351 (= C342), G352 (= G343), Q353 (≠ K344), C354 (= C345), C357 (= C348), T395 (= T386), C397 (= C388), L399 (= L390)
P49821 NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial; NDUFV1; Complex I-51kD; CI-51kD; NADH dehydrogenase flavoprotein 1; NADH-ubiquinone oxidoreductase 51 kDa subunit; EC 7.1.1.2 from Homo sapiens (Human) (see paper)
52% identity, 91% coverage: 39:420/421 of query aligns to 73:453/464 of P49821
- C379 (= C342) binding
- C382 (= C345) binding
- C385 (= C348) binding
- C425 (= C388) binding
P25708 NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial; NDUFV1; Complex I-51kD; CI-51kD; NADH dehydrogenase flavoprotein 1; NADH-ubiquinone oxidoreductase 51 kDa subunit; EC 7.1.1.2 from Bos taurus (Bovine) (see paper)
53% identity, 90% coverage: 39:416/421 of query aligns to 73:449/464 of P25708
- C379 (= C342) binding
- C382 (= C345) binding
- C385 (= C348) binding
- C425 (= C388) binding
Q91YT0 NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial; NDUFV1; Complex I-51kD; CI-51kD; NADH-ubiquinone oxidoreductase 51 kDa subunit; EC 7.1.1.2 from Mus musculus (Mouse) (see 2 papers)
53% identity, 88% coverage: 39:409/421 of query aligns to 73:446/464 of Q91YT0
- C379 (= C342) binding
- C382 (= C345) binding
- C385 (= C348) binding
- C425 (= C388) binding
Sites not aligning to the query:
- 1:20 modified: transit peptide, Mitochondrion
6saqB Wild-type nuoef from aquifex aeolicus bound to nadh-oh (see paper)
49% identity, 96% coverage: 5:409/421 of query aligns to 17:413/419 of 6saqB
- binding flavin mononucleotide: G64 (= G53), G66 (= G55), K75 (= K64), N91 (= N81), D93 (= D83), E94 (= E84), Y179 (= Y169), G182 (= G172), E183 (= E173), N218 (= N208), N219 (= N209), T222 (= T212)
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2~{R},3~{S},4~{R},5~{R})-5-[[(1~{E},3~{Z})-5-azanyl-4-oxidanyl-5-oxidanylidene-penta-1,3-dienyl]-methanoyl-amino]-3,4-bis(oxidanyl)oxolan-2-yl]methyl hydrogen phosphate: G66 (= G55), G67 (= G56), A68 (= A57), F70 (= F59), K75 (= K64), E94 (= E84), E96 (= E86), T99 (= T89), E184 (= E174), Y204 (≠ F194), T318 (≠ S314)
- binding iron/sulfur cluster: P198 (= P188), T345 (≠ S341), C346 (= C342), G347 (= G343), Q348 (≠ K344), C349 (= C345), C352 (= C348), I391 (≠ F387), C392 (= C388), G395 (= G391)
6q9cB Crystal structure of aquifex aeolicus nadh-quinone oxidoreductase subunits nuoe and nuof bound to nadh under anaerobic conditions (see paper)
49% identity, 96% coverage: 5:409/421 of query aligns to 17:413/418 of 6q9cB
- binding flavin mononucleotide: G64 (= G53), G66 (= G55), K75 (= K64), N91 (= N81), D93 (= D83), E94 (= E84), G182 (= G172), E183 (= E173), E184 (= E174), V217 (≠ I207), N218 (= N208), N219 (= N209), T222 (= T212), G393 (≠ A389)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G66 (= G55), G67 (= G56), A68 (= A57), F70 (= F59), K75 (= K64), E94 (= E84), E96 (= E86), Y179 (= Y169), E184 (= E174), Y204 (≠ F194)
- binding iron/sulfur cluster: P198 (= P188), T345 (≠ S341), C346 (= C342), G347 (= G343), Q348 (≠ K344), C349 (= C345), C352 (= C348), I391 (≠ F387), C392 (= C388), L394 (= L390), G395 (= G391)
7q5yC Structure of nadh:ubichinon oxidoreductase (complex i) of the hyperthermophilic eubacterium aquifex aeolicus
49% identity, 96% coverage: 5:409/421 of query aligns to 18:414/419 of 7q5yC
- binding flavin mononucleotide: G65 (= G53), G67 (= G55), K76 (= K64), N92 (= N81), E95 (= E84), Y180 (= Y169), G183 (= G172), E184 (= E173), V218 (≠ I207), N219 (= N208), N220 (= N209), T223 (= T212)
- binding iron/sulfur cluster: T346 (≠ S341), C347 (= C342), G348 (= G343), Q349 (≠ K344), C350 (= C345), C353 (= C348), S391 (≠ T386), I392 (≠ F387), C393 (= C388), G396 (= G391)
Query Sequence
>SMa1525 FitnessBrowser__Smeli:SMa1525
MFEPVLLRNVDVPDGHLLSTYEAGGGYRALRKALGEYTPDEIVELVKESNLRGRGGAGFP
TGMKWSFVPKAAGKPKYLCCNADEGEPGTFKDRIIMERDPHQLIEGLAVSAYAIGAETAY
VYIRGEYVTAIRRMEQAIAEAHENGYLGIGILGSGFNFMVHIHRGAGAYICGEETAMLES
LEGKRAQPRLKPPFPAVAGLYASPTVINNVETLACVPHIVMRGSAWFRGIGPDRSPGPKL
YCLSGQVRKPGLYELPMGISLRELVEEHAGGPLPGRKVKAVIPGGVSAPVIPEGELEVGM
DFDSLTAAGSMLGSAGVVVIDDSTCMVKLATRIIEFFHHESCGKCTPCREGLDWTVKVLR
RIEAGEGETGDLEQLEMLCKGIFGNTFCALGDGAAMGLRAALKHFRAEFVAHIEERRCPF
H
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory