Comparing SMa1741 FitnessBrowser__Smeli:SMa1741 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
43% identity, 84% coverage: 20:255/280 of query aligns to 26:261/265 of P07821
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
35% identity, 76% coverage: 20:231/280 of query aligns to 17:225/241 of 4u00A
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
30% identity, 82% coverage: 3:231/280 of query aligns to 30:252/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
30% identity, 82% coverage: 3:231/280 of query aligns to 30:252/382 of 7aheC
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
30% identity, 82% coverage: 3:231/280 of query aligns to 30:252/260 of 7ahdC
Sites not aligning to the query:
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
31% identity, 85% coverage: 5:241/280 of query aligns to 17:247/378 of P69874
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
29% identity, 81% coverage: 5:230/280 of query aligns to 1:224/240 of 4ymuJ
P0AAH0 Phosphate import ATP-binding protein PstB; ABC phosphate transporter; Phosphate-transporting ATPase; EC 7.3.2.1 from Escherichia coli (strain K12) (see paper)
32% identity, 83% coverage: 10:240/280 of query aligns to 15:257/257 of P0AAH0
Sites not aligning to the query:
5x40A Structure of a cbio dimer bound with amppcp (see paper)
37% identity, 81% coverage: 5:232/280 of query aligns to 4:230/280 of 5x40A
7a6fA Nanodisc reconstituted human abcb1 in complex with mrk16 fab and zosuquidar (see paper)
31% identity, 77% coverage: 20:235/280 of query aligns to 940:1154/1164 of 7a6fA
Sites not aligning to the query:
7a6eA Nanodisc reconstituted human abcb1 in complex with mrk16 fab and tariquidar (see paper)
31% identity, 77% coverage: 20:235/280 of query aligns to 940:1154/1164 of 7a6eA
Sites not aligning to the query:
7a6cA Nanodisc reconstituted human abcb1 in complex with mrk16 fab and elacridar (see paper)
31% identity, 77% coverage: 20:235/280 of query aligns to 940:1154/1164 of 7a6cA
Sites not aligning to the query:
7a69A Nanodisc reconstituted human abcb1 in complex with mrk16 fab and vincristine (see paper)
31% identity, 77% coverage: 20:235/280 of query aligns to 940:1154/1164 of 7a69A
Sites not aligning to the query:
7o9wA Encequidar-bound human p-glycoprotein in complex with uic2-fab (see paper)
31% identity, 77% coverage: 20:235/280 of query aligns to 945:1159/1169 of 7o9wA
Sites not aligning to the query:
6qexA Nanodisc reconstituted human abcb1 in complex with uic2 fab and taxol (see paper)
31% identity, 77% coverage: 20:235/280 of query aligns to 958:1172/1182 of 6qexA
Sites not aligning to the query:
1jj7A Crystal structure of thE C-terminal atpase domain of human tap1 (see paper)
30% identity, 76% coverage: 20:233/280 of query aligns to 29:242/251 of 1jj7A
Sites not aligning to the query:
7otgA Structure of abcb1/p-glycoprotein in the presence of the cftr potentiator ivacaftor (see paper)
32% identity, 77% coverage: 20:235/280 of query aligns to 956:1170/1179 of 7otgA
Sites not aligning to the query:
6q81A Structure of p-glycoprotein(abcb1) in the post-hydrolytic state (see paper)
32% identity, 77% coverage: 20:235/280 of query aligns to 959:1173/1182 of 6q81A
Sites not aligning to the query:
4xwkA P-glycoprotein co-crystallized with bde-100 (see paper)
32% identity, 77% coverage: 20:235/280 of query aligns to 957:1171/1182 of 4xwkA
Sites not aligning to the query:
4q9iA P-glycoprotein cocrystallised with qz-ala (see paper)
32% identity, 77% coverage: 20:235/280 of query aligns to 954:1168/1184 of 4q9iA
Sites not aligning to the query:
>SMa1741 FitnessBrowser__Smeli:SMa1741
MTDHLLVASGLTAGYDKTEILHALDLTIPPRKITVIVGANACGKSTFLRTLSRLIAPSKG
QVLLDGKSIHRTPSRDLARTLGLLPQSPIAPEGITVVDLVSRGRHPHQSLFSGWTRRDDE
AVDSALRATKTFDLADRPIDELSGGQRQRVWIAMALAQQTDILLLDEPTTFLDINHQIEV
LDLLTDLNSARRTTVVMVLHDLNLAARYADHLVAIAGGRVHISGTPEEVLTEETVRHVFG
LDSRVISDPTSGRPIMLPIGRHRTAVIDDMGDAPQKERSA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory