SitesBLAST
Comparing SMa1838 FitnessBrowser__Smeli:SMa1838 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5vg6B Crystal structure of d-isomer specific 2-hydroxyacid dehydrogenase from xanthobacter autotrophicus py2 in complex with NADPH and mes.
42% identity, 89% coverage: 36:307/307 of query aligns to 43:315/315 of 5vg6B
- active site: M98 (≠ I90), R230 (= R222), D254 (= D246), E259 (= E251), H278 (= H270)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A74 (= A66), R92 (= R84), M102 (= M94), L147 (= L139), G148 (= G140), D149 (≠ M141), L150 (= L142), W168 (= W160), S169 (= S161), R170 (= R162), T171 (≠ S163), K173 (≠ H165), L201 (= L193), P202 (= P194), T207 (= T199), V228 (= V220), R230 (= R222), H278 (= H270), A280 (= A272), S281 (= S273), Y315 (= Y307)
7jqiA Structure of wild type glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with alpha-ketoglutarate and NADP+
37% identity, 89% coverage: 36:307/307 of query aligns to 35:312/312 of 7jqiA
- binding 2-oxoglutaric acid: G64 (= G65), A65 (= A66), G66 (= G67), R227 (= R222), H275 (= H270)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A65 (= A66), R89 (= R84), M99 (= M94), A144 (≠ L139), G145 (= G140), V146 (≠ M141), L147 (= L142), W165 (= W160), S166 (= S161), R167 (= R162), T168 (≠ S163), K170 (≠ H165), L198 (= L193), P199 (= P194), L225 (≠ V220), R227 (= R222), H275 (= H270), A278 (≠ S273), Y312 (= Y307)
6p35A 2.5 angstrom structure of wild type glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with 2-keto arginine and NADP
37% identity, 89% coverage: 36:307/307 of query aligns to 35:312/312 of 6p35A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A65 (= A66), R89 (= R84), M99 (= M94), A144 (≠ L139), G145 (= G140), V146 (≠ M141), L147 (= L142), W165 (= W160), S166 (= S161), R167 (= R162), T168 (≠ S163), K170 (≠ H165), L198 (= L193), P199 (= P194), L225 (≠ V220), R227 (= R222), H275 (= H270), A277 (= A272), A278 (≠ S273), Y312 (= Y307)
- binding 5-[(diaminomethylidene)amino]-2-oxopentanoic acid: A65 (= A66), R227 (= R222), H275 (= H270), T280 (= T275)
Sites not aligning to the query:
7jqhA Structure of wild type glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with phosphate and NADP+
37% identity, 89% coverage: 36:307/307 of query aligns to 36:313/313 of 7jqhA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A66 (= A66), R90 (= R84), M100 (= M94), A145 (≠ L139), G146 (= G140), V147 (≠ M141), L148 (= L142), W166 (= W160), S167 (= S161), R168 (= R162), T169 (≠ S163), K171 (≠ H165), L199 (= L193), P200 (= P194), L226 (≠ V220), A227 (≠ G221), R228 (= R222), D252 (= D246), H276 (= H270), A279 (≠ S273), Y313 (= Y307)
4zqbB Crystal structure of NADP-dependent dehydrogenase from rhodobactersphaeroides in complex with NADP and sulfate
43% identity, 84% coverage: 49:307/307 of query aligns to 58:316/316 of 4zqbB
- active site: L99 (≠ I90), R231 (= R222), E260 (= E251), H279 (= H270)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R93 (= R84), M103 (= M94), G147 (= G138), L148 (= L139), G149 (= G140), E150 (≠ M141), L151 (= L142), W169 (= W160), S170 (= S161), R171 (= R162), S172 (= S163), K174 (≠ H165), L202 (= L193), P203 (= P194), F229 (≠ V220), R231 (= R222), H279 (= H270), S281 (≠ A272), A282 (≠ S273), Y316 (= Y307)
3kboA 2.14 angstrom crystal structure of putative oxidoreductase (ycdw) from salmonella typhimurium in complex with NADP
36% identity, 89% coverage: 36:307/307 of query aligns to 35:312/312 of 3kboA
- active site: M95 (≠ I90), R227 (= R222), E256 (= E251), H275 (= H270)
- binding N-(2-hydroxyethyl)-N,N-dimethyl-3-sulfopropan-1-aminium: N36 (≠ P37), A53 (≠ R54), R55 (= R56), R56 (≠ S57)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R89 (= R84), M99 (= M94), G143 (= G138), A144 (≠ L139), G145 (= G140), V146 (≠ M141), L147 (= L142), W165 (= W160), S166 (= S161), R167 (= R162), S168 (= S163), K170 (≠ H165), L197 (= L192), P199 (= P194), L225 (≠ V220), A226 (≠ G221), R227 (= R222), D251 (= D246), H275 (= H270), A278 (≠ S273), Y312 (= Y307)
4z0pA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc02828 (smghra) from sinorhizobium meliloti in complex with NADPH and oxalate (see paper)
38% identity, 93% coverage: 21:307/307 of query aligns to 26:316/316 of 4z0pA
- active site: L95 (≠ I90), R231 (= R222), G250 (≠ S241), D255 (= D246), E260 (= E251), H279 (= H270)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R89 (= R84), M99 (= M94), M144 (≠ L139), G145 (= G140), V146 (≠ M141), L147 (= L142), W165 (= W160), S166 (= S161), R167 (= R162), S168 (= S163), R170 (≠ H165), L197 (= L193), P198 (= P194), A229 (≠ V220), G230 (= G221), R231 (= R222), H279 (= H270), A281 (= A272), A282 (≠ S273), Y316 (= Y307)
- binding oxalic acid: W50 (= W46), G70 (= G65), A71 (= A66), G72 (= G67), H114 (≠ L109), R115 (≠ P110), R231 (= R222), H279 (= H270)
4weqA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc02828 (smghra) from sinorhizobium meliloti in complex with NADP and sulfate (see paper)
38% identity, 93% coverage: 21:307/307 of query aligns to 26:316/316 of 4weqA
- active site: L95 (≠ I90), R231 (= R222), G250 (≠ S241), D255 (= D246), E260 (= E251), H279 (= H270)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R89 (= R84), M99 (= M94), M144 (≠ L139), G145 (= G140), V146 (≠ M141), L147 (= L142), W165 (= W160), S166 (= S161), R167 (= R162), S168 (= S163), R170 (≠ H165), L197 (= L193), P198 (= P194), A229 (≠ V220), G230 (= G221), R231 (= R222), D255 (= D246), H279 (= H270), A281 (= A272), Y316 (= Y307)
5bqfA Probable 2-hydroxyacid dehydrogenase from rhizobium etli cfn 42 in complex with NADP, hepes and l(+)-tartaric acid
36% identity, 90% coverage: 31:307/307 of query aligns to 34:317/317 of 5bqfA
- active site: E261 (= E251), H280 (= H270)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A72 (= A66), R90 (= R84), M100 (= M94), G144 (= G138), L145 (= L139), G146 (= G140), I147 (≠ M141), L148 (= L142), W166 (= W160), S167 (= S161), R168 (= R162), T169 (≠ S163), L198 (= L193), P199 (= P194), A230 (≠ V220), G231 (= G221), R232 (= R222), H280 (= H270), A283 (≠ S273), Y317 (= Y307)
4xcvA Probable 2-hydroxyacid dehydrogenase from rhizobium etli cfn 42 in complex with NADPH
36% identity, 90% coverage: 31:307/307 of query aligns to 34:317/317 of 4xcvA
- active site: E261 (= E251), H280 (= H270)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A72 (= A66), R90 (= R84), M100 (= M94), G144 (= G138), L145 (= L139), G146 (= G140), I147 (≠ M141), L148 (= L142), W166 (= W160), S167 (= S161), R168 (= R162), T169 (≠ S163), K171 (≠ H165), L198 (= L193), P199 (= P194), A230 (≠ V220), G231 (= G221), R232 (= R222), H280 (= H270), A283 (≠ S273), Y317 (= Y307)
5tsdA Crystal structure of NADPH-dependent 2-hydroxyacid dehydrogenase from rhizobium etli cfn 42 in complex with NADPH and oxalate
36% identity, 90% coverage: 31:307/307 of query aligns to 33:316/316 of 5tsdA
- active site: E260 (= E251), H279 (= H270)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A71 (= A66), R89 (= R84), M99 (= M94), G143 (= G138), L144 (= L139), G145 (= G140), I146 (≠ M141), L147 (= L142), W165 (= W160), S166 (= S161), R167 (= R162), T168 (≠ S163), K170 (≠ H165), L197 (= L193), P198 (= P194), A229 (≠ V220), G230 (= G221), R231 (= R222), D255 (= D246), H279 (= H270), Y316 (= Y307)
- binding oxalic acid: W50 (= W46), G70 (= G65), A71 (= A66), G72 (= G67), R231 (= R222), H279 (= H270)
7arzA Ternary complex of NAD-dependent formate dehydrogenase from physcomitrium patens
31% identity, 75% coverage: 46:275/307 of query aligns to 84:320/361 of 7arzA
- binding azide ion: L99 (= L61), V100 (≠ F62), T101 (≠ S63), G103 (= G65), V104 (≠ A66), R267 (= R222), H315 (= H270)
- binding nicotinamide-adenine-dinucleotide: V104 (≠ A66), N128 (≠ I90), V132 (≠ M94), G182 (= G140), R183 (≠ M141), I184 (≠ L142), D204 (≠ S161), R205 (= R162), T238 (≠ L193), P239 (= P194), Q243 (≠ E198), N265 (≠ V220), A266 (≠ G221), R267 (= R222), D291 (= D246), H315 (= H270), S317 (≠ A272), G318 (≠ S273)
Sites not aligning to the query:
5mh6A D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with 2-ketohexanoic acid and NAD+ (1.35 a resolution)
34% identity, 65% coverage: 96:296/307 of query aligns to 95:300/306 of 5mh6A
- binding 2-Ketohexanoic acid: R224 (= R222), H272 (= H270), Y280 (vs. gap)
- binding magnesium ion: T130 (≠ Q128), A132 (≠ V130), F210 (= F208), E211 (≠ A209), M213 (≠ L211), G225 (= G223), P226 (= P224), V228 (≠ L226), E230 (≠ H228), D241 (≠ H239), S251 (≠ D249)
- binding nicotinamide-adenine-dinucleotide: G142 (= G140), T143 (≠ M141), L144 (= L142), R164 (= R162), P196 (= P194), T201 (= T199), V222 (= V220), A223 (≠ G221), R224 (= R222), H272 (= H270), S274 (≠ A272)
Sites not aligning to the query:
5mhaB D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with a mixture of 2-ketohexanoic acid and 2-hydroxyhexanoic acid, and NADPH (1.57 a resolution)
34% identity, 65% coverage: 96:296/307 of query aligns to 97:302/308 of 5mhaB
- binding 2-Ketohexanoic acid: R226 (= R222), H274 (= H270), Y282 (vs. gap)
- binding (2R)-2-hydroxyhexanoic acid: Y282 (vs. gap)
- binding magnesium ion: F212 (= F208), E213 (≠ A209), M215 (≠ L211), D243 (≠ H239)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L143 (= L139), G144 (= G140), T145 (≠ M141), L146 (= L142), R165 (≠ S161), R166 (= R162), S167 (= S163), P180 (≠ R176), T197 (≠ L193), P198 (= P194), T203 (= T199), V224 (= V220), A225 (≠ G221), R226 (= R222), H274 (= H270), S276 (≠ A272)
Sites not aligning to the query:
5mhaA D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with a mixture of 2-ketohexanoic acid and 2-hydroxyhexanoic acid, and NADPH (1.57 a resolution)
34% identity, 65% coverage: 96:296/307 of query aligns to 97:302/308 of 5mhaA
- binding 2-Ketohexanoic acid: R226 (= R222), H274 (= H270), Y282 (vs. gap)
- binding magnesium ion: T132 (≠ Q128), A134 (≠ V130)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L143 (= L139), G144 (= G140), T145 (≠ M141), L146 (= L142), R165 (≠ S161), R166 (= R162), S167 (= S163), P180 (≠ R176), T197 (≠ L193), P198 (= P194), T203 (= T199), V224 (= V220), A225 (≠ G221), R226 (= R222), H274 (= H270), S276 (≠ A272)
Sites not aligning to the query:
5mh5A D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with 2-keto-hexanoic acid and NADP+ (1.4 a resolution)
34% identity, 65% coverage: 96:296/307 of query aligns to 97:302/308 of 5mh5A
- binding 2-Ketohexanoic acid: R226 (= R222), H274 (= H270), Y282 (vs. gap)
- binding magnesium ion: T132 (≠ Q128), A134 (≠ V130), F212 (= F208), E213 (≠ A209), M215 (≠ L211), D243 (≠ H239)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G142 (= G138), L143 (= L139), G144 (= G140), T145 (≠ M141), L146 (= L142), R165 (≠ S161), R166 (= R162), S167 (= S163), T197 (≠ L193), P198 (= P194), T203 (= T199), V224 (= V220), A225 (≠ G221), R226 (= R222), H274 (= H270), S276 (≠ A272)
Sites not aligning to the query:
2gcgA Ternary crystal structure of human glyoxylate reductase/hydroxypyruvate reductase (see paper)
28% identity, 72% coverage: 57:276/307 of query aligns to 70:295/324 of 2gcgA
- active site: L103 (≠ I90), R241 (= R222), D265 (= D246), E270 (= E251), H289 (= H270)
- binding (2r)-2,3-dihydroxypropanoic acid: S78 (≠ G65), V79 (≠ A66), G80 (= G67), R241 (= R222), H289 (= H270)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V79 (≠ A66), T107 (≠ M94), G156 (= G138), G158 (= G140), I160 (≠ L142), G180 (= G159), R181 (= R162), R184 (≠ H165), C212 (≠ L193), S213 (≠ P194), T218 (= T199), I239 (≠ V220), R241 (= R222), D265 (= D246), H289 (= H270), G291 (≠ A272)
Sites not aligning to the query:
Q9UBQ7 Glyoxylate reductase/hydroxypyruvate reductase; EC 1.1.1.79; EC 1.1.1.81 from Homo sapiens (Human) (see paper)
28% identity, 72% coverage: 57:276/307 of query aligns to 74:299/328 of Q9UBQ7
6t9wB Crystal structure of formate dehydrogenase fdh2 d222a/q223r enzyme from granulicella mallensis mp5actx8 in complex with NADP and azide.
29% identity, 84% coverage: 19:275/307 of query aligns to 83:337/383 of 6t9wB
- binding azide ion: P97 (= P37), F98 (≠ D38), G121 (= G65), I122 (≠ A66), H332 (= H270)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I122 (≠ A66), N146 (≠ I90), S147 (≠ V91), V150 (≠ M94), A198 (≠ G138), G200 (= G140), R201 (≠ M141), I202 (≠ L142), F220 (≠ W160), R222 (= R162), P256 (= P194), H258 (≠ T196), T261 (= T199), T282 (≠ V220), A283 (≠ G221), R284 (= R222), D308 (= D246), H332 (= H270), S334 (≠ A272), G335 (≠ S273)
Sites not aligning to the query:
8bxxAA Formate dehydrogenase
29% identity, 84% coverage: 19:275/307 of query aligns to 83:337/370 of 8bxxAA
- binding azide ion: P97 (= P37), F98 (≠ D38), I122 (≠ A66), R284 (= R222), H332 (= H270)
- binding nicotinamide-adenine-dinucleotide: I122 (≠ A66), N146 (≠ I90), V150 (≠ M94), A198 (≠ G138), G200 (= G140), R201 (≠ M141), I202 (≠ L142), F220 (≠ W160), D221 (≠ S161), Q222 (vs. gap), P256 (= P194), H258 (≠ T196), T282 (≠ V220), A283 (≠ G221), R284 (= R222), D308 (= D246), H332 (= H270), S334 (≠ A272), G335 (≠ S273)
Query Sequence
>SMa1838 FitnessBrowser__Smeli:SMa1838
MAFLFNSDAKRGAIFAETFARELPDIPFAVDPAAVDPDAVRYLITWTVPDNLARYRSLEI
LFSIGAGVDQFRIDAVPPHVRVVRMVEDGIVRMMQEYVTLAVLAHHRNLPAYLEQQQGEN
WQAIAPVQAVERRVGVLGLGMLGTAVLDRLKPFGFPLSGWSRSPHEIEGVRCLSGRNGLD
TLLGSTDILVCLLPLTDETRGFLNAQLFARLPAGAALVHVGRGPQLDHDALVEGLDKGHL
SGAMVDVTDPEPLPSGHRFWTHPKILLTPHIASVTQPETAARAVIENIKRHRQGLEPIGL
VDRRRGY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory