Comparing SMa1855 FitnessBrowser__Smeli:SMa1855 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7ypmA Crystal structure of transaminase cc1012 complexed with plp and l- alanine (see paper)
40% identity, 97% coverage: 4:445/458 of query aligns to 1:446/454 of 7ypmA
5kr6B Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
39% identity, 98% coverage: 3:449/458 of query aligns to 6:459/460 of 5kr6B
7ypnD Crystal structure of transaminase cc1012 mutant m9 complexed with plp (see paper)
40% identity, 99% coverage: 4:457/458 of query aligns to 1:455/455 of 7ypnD
5kr5A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
39% identity, 97% coverage: 4:446/458 of query aligns to 3:452/455 of 5kr5A
7qx0B Transaminase structure of plurienzyme (tr2e2) in complex with plp (see paper)
40% identity, 96% coverage: 9:446/458 of query aligns to 8:438/443 of 7qx0B
5kquC Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
39% identity, 97% coverage: 4:446/458 of query aligns to 5:454/459 of 5kquC
6fyqA The crystal structure of a new transaminase from the marine bacterium virgibacillus (see paper)
37% identity, 96% coverage: 5:443/458 of query aligns to 2:435/443 of 6fyqA
7qx3A Structure of the transaminase tr2e2 with eos (see paper)
41% identity, 91% coverage: 30:446/458 of query aligns to 2:417/422 of 7qx3A
5kr3A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
39% identity, 97% coverage: 4:449/458 of query aligns to 6:456/458 of 5kr3A
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
40% identity, 97% coverage: 5:448/458 of query aligns to 7:448/448 of 6io1B
6gwiB The crystal structure of halomonas elongata amino-transferase (see paper)
38% identity, 97% coverage: 1:446/458 of query aligns to 1:445/450 of 6gwiB
3fcrA Crystal structure of putative aminotransferase (yp_614685.1) from silicibacter sp. Tm1040 at 1.80 a resolution
39% identity, 98% coverage: 1:447/458 of query aligns to 3:457/458 of 3fcrA
6g4dB Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp (see paper)
38% identity, 97% coverage: 4:448/458 of query aligns to 1:447/453 of 6g4dB
6g4fA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with pmp (see paper)
38% identity, 97% coverage: 4:448/458 of query aligns to 1:447/451 of 6g4fA
6g4eA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp and 6-aminohexanoate (6-aca) (see paper)
38% identity, 97% coverage: 4:448/458 of query aligns to 1:447/451 of 6g4eA
3gjuA Crystal structure of a putative aminotransferase (mll7127) from mesorhizobium loti maff303099 at 1.55 a resolution
38% identity, 97% coverage: 3:447/458 of query aligns to 6:457/458 of 3gjuA
6s54A Transaminase from pseudomonas fluorescens (see paper)
38% identity, 94% coverage: 6:437/458 of query aligns to 8:442/453 of 6s54A
7q9xAAA Probable aminotransferase
36% identity, 96% coverage: 8:448/458 of query aligns to 8:450/455 of 7q9xAAA
4a6tC Crystal structure of the omega transaminase from chromobacterium violaceum in complex with plp (see paper)
36% identity, 96% coverage: 8:448/458 of query aligns to 8:450/455 of 4a6tC
6s4gA Crystal structure of the omega transaminase from chromobacterium violaceum in complex with pmp (see paper)
36% identity, 96% coverage: 8:448/458 of query aligns to 7:449/453 of 6s4gA
>SMa1855 FitnessBrowser__Smeli:SMa1855
MYSNSLIELDRAHLIHPVASYRGHEKLGVRVLASAKGATVTDASGRQLIDGFAGLWCVNA
GYGQETIVEAAAKQMRELSYATAYFGLGSEPAIRLASELAERAPGNLNHVYFTLGGSDAV
DSTIRFIRYYWTARGEPQRDQFISVEQGYHGSSTVGAGLTALPAFHTGFGIPFDWQHKIP
SHYAYRNPVGDDPQAIIAASLTALRRKVEEIGPERVAAFYAEPIQGSGGVLVPPRGWMKA
MRELCRDLGILFVADEVITGFGRTGPLFASTENEIVPDFITTAKGLTSGYVPMGAVFMAD
HIYQTIADGAGASAVGHGYTYSAHPVSAAVGLEVLRLYENGLLENGVKAGARLMEGLGSL
RDHPLVGDVRGRGMLAAIELVVDKAQKTPLPAAAEPARRIFDRAWENGLVIRAFANGVLG
YAPPLCCSETEIDAIIERTRQSLDETLEDPDVRRALKT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory