SitesBLAST
Comparing SMa1871 FitnessBrowser__Smeli:SMa1871 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1omoA Alanine dehydrogenase dimer w/bound NAD (archaeal) (see paper)
38% identity, 100% coverage: 1:329/330 of query aligns to 1:320/320 of 1omoA
- active site: R52 (= R50), D219 (= D228)
- binding nicotinamide-adenine-dinucleotide: T109 (= T115), G134 (= G140), T135 (≠ N141), Q136 (= Q142), Y156 (≠ W162), D157 (≠ S163), V158 (≠ R164), R159 (≠ T165), T195 (= T204), P196 (≠ R205), G217 (= G226), D219 (= D228), K223 (= K232), S290 (= S299), T291 (= T300), G292 (= G301)
O28608 Alanine dehydrogenase; AlaDH; EC 1.4.1.1 from Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16) (see paper)
38% identity, 100% coverage: 1:329/330 of query aligns to 1:320/322 of O28608
6t3eB Structure of thermococcus litoralis delta(1)-pyrroline-2-carboxylate reductase in complex with nadh and l-proline (see paper)
35% identity, 98% coverage: 4:328/330 of query aligns to 2:325/325 of 6t3eB
- binding 1,4-dihydronicotinamide adenine dinucleotide: S82 (≠ N86), T111 (= T115), G136 (= G140), V137 (≠ N141), Q138 (= Q142), D159 (≠ S163), I160 (≠ R164), A199 (≠ T203), T200 (= T204), T201 (≠ R205), A202 (≠ G206), V206 (≠ L210), V221 (≠ I225), G222 (= G226), W223 (≠ T227), S296 (= S299), V297 (≠ T300), G298 (= G301)
- binding proline: R39 (≠ Y41), M54 (≠ K56), K67 (= K69), R110 (= R114)
6rqaB Crystal structure of the iminosuccinate reductase of paracoccus denitrificans in complex with NAD+ (see paper)
38% identity, 83% coverage: 45:317/330 of query aligns to 48:311/322 of 6rqaB
- binding Tb-Xo4: E49 (≠ H46), D50 (≠ P47), N76 (= N78)
- binding nicotinamide-adenine-dinucleotide: T113 (= T115), G138 (= G140), Q140 (= Q142), P162 (≠ R164), H163 (≠ T165), I199 (≠ T203), T200 (= T204), S201 (≠ R205), S202 (≠ G206), M221 (≠ I225), G222 (= G226), D224 (= D228), K228 (= K232), G293 (≠ S299), T294 (= T300), G295 (= G301)
6rqaA Crystal structure of the iminosuccinate reductase of paracoccus denitrificans in complex with NAD+ (see paper)
38% identity, 83% coverage: 45:317/330 of query aligns to 48:311/322 of 6rqaA
- binding nicotinamide-adenine-dinucleotide: H85 (≠ S87), T113 (= T115), G138 (= G140), H139 (≠ N141), Q140 (= Q142), N161 (≠ S163), P162 (≠ R164), H163 (≠ T165), M166 (≠ S168), I199 (≠ T203), T200 (= T204), S201 (≠ R205), S202 (≠ G206), M221 (≠ I225), G222 (= G226), D224 (= D228), K228 (= K232), G293 (≠ S299)
A1B8Z0 Iminosuccinate reductase; EC 1.4.1.- from Paracoccus denitrificans (strain Pd 1222) (see paper)
38% identity, 83% coverage: 45:317/330 of query aligns to 46:309/320 of A1B8Z0
4mp6A Staphyloferrin b precursor biosynthetic enzyme sbnb bound to citrate and NAD+ (see paper)
30% identity, 94% coverage: 21:329/330 of query aligns to 23:334/334 of 4mp6A
- active site: I60 (= I66), M236 (≠ Q233)
- binding nicotinamide-adenine-dinucleotide: R92 (≠ N86), R120 (= R114), T121 (= T115), G146 (= G140), L147 (≠ N141), I148 (≠ Q142), D170 (≠ S163), Q171 (≠ R164), C211 (≠ T203), T212 (= T204), V213 (≠ R205), I233 (= I225), G306 (= G301)
4bv9A Crystal structure of the NADPH form of mouse mu-crystallin. (see paper)
33% identity, 71% coverage: 82:316/330 of query aligns to 78:300/303 of 4bv9A
- active site: S220 (≠ D228)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S82 (≠ N86), H83 (≠ S87), T111 (= T115), G134 (= G138), G136 (= G140), V137 (≠ N141), Q138 (= Q142), N159 (≠ S163), R160 (= R164), T161 (= T165), V195 (≠ T203), T196 (= T204), M197 (≠ R205), A198 (≠ G206), V217 (≠ I225), G218 (= G226), S283 (= S299), L284 (≠ T300), G285 (= G301)
- binding pyruvic acid: R110 (= R114)
Sites not aligning to the query:
2i99A Crystal structure of human mu_crystallin at 2.6 angstrom (see paper)
31% identity, 90% coverage: 20:316/330 of query aligns to 22:308/312 of 2i99A
- active site: G59 (≠ D54), S228 (≠ D228)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: D81 (≠ N77), S90 (≠ N86), H91 (≠ S87), R118 (= R114), T119 (= T115), G142 (= G138), A143 (≠ T139), G144 (= G140), V145 (≠ N141), Q146 (= Q142), N167 (≠ S163), R168 (= R164), T169 (= T165), V203 (≠ T203), T204 (= T204), L205 (≠ R205), A206 (≠ G206), V225 (≠ I225), G226 (= G226), S291 (= S299), L292 (≠ T300), G293 (= G301)
Q14894 Ketimine reductase mu-crystallin; NADP-regulated thyroid-hormone-binding protein; EC 1.5.1.25 from Homo sapiens (Human) (see paper)
31% identity, 90% coverage: 20:316/330 of query aligns to 23:309/314 of Q14894
4mpdA Staphyloferrin b precursor biosynthetic enzyme sbnb bound a- ketoglutarate and NAD+ (see paper)
29% identity, 94% coverage: 21:329/330 of query aligns to 23:318/318 of 4mpdA
- active site: I53 (= I66), M224 (≠ Q233)
- binding 2-oxoglutaric acid: K43 (≠ H46), R51 (≠ E64), M55 (= M68), K64 (vs. gap), I66 (vs. gap), R80 (≠ N86), M289 (≠ T300)
- binding nicotinamide-adenine-dinucleotide (acidic form): R80 (≠ N86), R108 (= R114), T109 (= T115), G134 (= G140), I136 (≠ Q142), D158 (≠ S163), Q159 (≠ R164), F160 (≠ T165), T200 (= T204), V201 (≠ R205), I221 (= I225)
4bvaA Crystal structure of the NADPH-t3 form of mouse mu-crystallin. (see paper)
34% identity, 69% coverage: 89:316/330 of query aligns to 84:299/303 of 4bvaA
- active site: S219 (≠ D228)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: T106 (= T111), R109 (= R114), T110 (= T115), G135 (= G140), V136 (≠ N141), Q137 (= Q142), N158 (≠ S163), R159 (= R164), T160 (= T165), N163 (≠ S168), V194 (≠ T203), T195 (= T204), M196 (≠ R205), A197 (≠ G206), V216 (≠ I225), S282 (= S299), L283 (≠ T300), G284 (= G301)
- binding 3,5,3'triiodothyronine: S219 (≠ D228), R220 (≠ Q229), W223 (≠ K232), E247 (= E255)
Sites not aligning to the query:
4m54A The structure of the staphyloferrin b precursor biosynthetic enzyme sbnb bound to n-(1-amino-1-carboxyl-2-ethyl)-glutamic acid and nadh (see paper)
29% identity, 94% coverage: 21:329/330 of query aligns to 23:310/310 of 4m54A
- active site: I55 (= I66), M231 (≠ Q233)
- binding N-[(2S)-2-amino-2-carboxyethyl]-L-glutamic acid: Y45 (≠ S48), R53 (≠ E64), M57 (= M68), K71 (vs. gap), I73 (vs. gap), R87 (≠ N86), R115 (= R114)
- binding 1,4-dihydronicotinamide adenine dinucleotide: R87 (≠ N86), T116 (= T115), G141 (= G140), L142 (≠ N141), I143 (≠ Q142), D165 (≠ S163), Q166 (≠ R164), T207 (= T204), T209 (≠ G206), I228 (= I225)
1u7hA Structure and a proposed mechanism for ornithine cyclodeaminase from pseudomonas putida (see paper)
33% identity, 71% coverage: 92:324/330 of query aligns to 89:317/341 of 1u7hA
- active site: D227 (= D228)
- binding nicotinamide-adenine-dinucleotide: R111 (= R114), T112 (= T115), G137 (= G140), A138 (≠ N141), Q139 (= Q142), D160 (≠ S163), T161 (≠ R164), V200 (≠ T203), T201 (= T204), A202 (≠ R205), I209 (≠ L210), V224 (≠ I225), G225 (= G226), D227 (= D228), K231 (= K232), S292 (= S299), V293 (≠ T300), G294 (= G301)
Sites not aligning to the query:
1x7dA Crystal structure analysis of ornithine cyclodeaminase complexed with NAD and ornithine to 1.6 angstroms (see paper)
33% identity, 71% coverage: 92:324/330 of query aligns to 89:317/340 of 1x7dA
- active site: D227 (= D228)
- binding nicotinamide-adenine-dinucleotide: R111 (= R114), T112 (= T115), G137 (= G140), A138 (≠ N141), Q139 (= Q142), D160 (≠ S163), T161 (≠ R164), V200 (≠ T203), T201 (= T204), A202 (≠ R205), I209 (≠ L210), V224 (≠ I225), G225 (= G226), D227 (= D228), K231 (= K232), S292 (= S299), V293 (≠ T300), G294 (= G301)
- binding L-ornithine: R111 (= R114), D227 (= D228), V293 (≠ T300)
Sites not aligning to the query:
Q88H32 Ornithine cyclodeaminase; OCD; EC 4.3.1.12 from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) (see paper)
33% identity, 71% coverage: 92:324/330 of query aligns to 90:318/350 of Q88H32
Sites not aligning to the query:
- 45 binding
- 69 binding
- 84 binding
- 331 binding
5gziA Cyclodeaminase_pa
31% identity, 75% coverage: 78:323/330 of query aligns to 89:329/354 of 5gziA
- binding nicotinamide-adenine-dinucleotide: T97 (≠ N86), R125 (= R114), T126 (= T115), G151 (= G140), A152 (≠ N141), Q153 (= Q142), D174 (≠ S163), T175 (≠ R164), H179 (vs. gap), A212 (≠ T203), T213 (= T204), S214 (≠ R205), V215 (vs. gap), V237 (≠ I225), G238 (= G226), A239 (≠ T227), S305 (= S299), T306 (= T300), G307 (= G301)
- binding (2S)-piperidine-2-carboxylic acid: R125 (= R114), A239 (≠ T227), T306 (= T300), G307 (= G301)
Sites not aligning to the query:
5yu4A Structural basis for recognition of l-lysine, l-ornithine, and l-2,4- diamino butyric acid by lysine cyclodeaminase (see paper)
31% identity, 75% coverage: 78:323/330 of query aligns to 85:325/344 of 5yu4A
- binding 2,4-diaminobutyric acid: R121 (= R114), T302 (= T300), G303 (= G301)
- binding nicotinamide-adenine-dinucleotide: T93 (≠ N86), I94 (≠ S87), R121 (= R114), T122 (= T115), G147 (= G140), A148 (≠ N141), Q149 (= Q142), D170 (≠ S163), T171 (≠ R164), H175 (vs. gap), A208 (≠ T203), T209 (= T204), S210 (≠ R205), V211 (vs. gap), V218 (≠ L210), V233 (≠ I225), A235 (≠ T227), S301 (= S299), T302 (= T300), G303 (= G301)
Sites not aligning to the query:
5yu3A Structural basis for recognition of l-lysine, l-ornithine, and l-2,4- diamino butyric acid by lysine cyclodeaminase (see paper)
31% identity, 75% coverage: 78:323/330 of query aligns to 85:325/344 of 5yu3A
- binding nicotinamide-adenine-dinucleotide: T93 (≠ N86), I94 (≠ S87), T122 (= T115), G147 (= G140), A148 (≠ N141), Q149 (= Q142), D170 (≠ S163), T171 (≠ R164), A208 (≠ T203), T209 (= T204), S210 (≠ R205), V211 (vs. gap), V233 (≠ I225), A235 (≠ T227), S301 (= S299), T302 (= T300), G303 (= G301)
- binding proline: R121 (= R114)
Sites not aligning to the query:
5gzlA Cyclodeaminase_pa
31% identity, 75% coverage: 78:323/330 of query aligns to 89:329/357 of 5gzlA
- binding lysine: D240 (= D228), R267 (≠ E255), E268 (≠ K256)
- binding nicotinamide-adenine-dinucleotide: T97 (≠ N86), I98 (≠ S87), T126 (= T115), G151 (= G140), A152 (≠ N141), Q153 (= Q142), D174 (≠ S163), T175 (≠ R164), H179 (vs. gap), A212 (≠ T203), T213 (= T204), S214 (≠ R205), V222 (≠ L210), V237 (≠ I225), G238 (= G226), A239 (≠ T227), D240 (= D228), K244 (= K232), S305 (= S299), T306 (= T300), G307 (= G301)
Sites not aligning to the query:
Query Sequence
>SMa1871 FitnessBrowser__Smeli:SMa1871
MKTLLLKKDEVRRLIGMAEVIGAVEEAYKAFSSDQVEQPDYIGIHHPSLRGEIDFKLGYY
KANEIISMKAHSGGFTNNPAEHGVPNSIGTILLFDARSCALICIMDGSLITGLRTGASGA
VSVKALARKNARTVASIGTGNQARMQIRAVNEIMKIEKIHAWSRTPESLSRYKTDIQREF
GIPVIVASSKKEAVEQADILITTTRGKGSLVEADWVKPGTHIVAIGTDQRGKQELDPEIF
RNAKVVVDSVAQCTEKGETWHPLNKNIITKDDIHGEIGEVLLGRKPGRESDDEITIFDST
GMAIQDNTTASKIYQNAIANNVGTFFQFFE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory