SitesBLAST
Comparing SMa1872 FitnessBrowser__Smeli:SMa1872 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q7XSN8 Serine racemase; D-serine dehydratase; D-serine ammonia-lyase; L-serine dehydratase; L-serine ammonia-lyase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Oryza sativa subsp. japonica (Rice) (see paper)
37% identity, 95% coverage: 7:312/323 of query aligns to 21:329/339 of Q7XSN8
- E219 (= E205) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-225.
- D225 (≠ K211) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-219.
3l6bA X-ray crystal structure of human serine racemase in complex with malonate a potent inhibitor (see paper)
37% identity, 95% coverage: 6:312/323 of query aligns to 6:312/322 of 3l6bA
- active site: K54 (= K54), S77 (= S79), E203 (= E205), A207 (≠ T209), D209 (≠ K211), G232 (= G233), T278 (≠ A280), L305 (= L305), S306 (= S306)
- binding malonate ion: K54 (= K54), S76 (= S78), S77 (= S79), N79 (= N81), H80 (= H82), R128 (= R130), G232 (= G233)
- binding manganese (ii) ion: E203 (= E205), A207 (≠ T209), D209 (≠ K211)
- binding pyridoxal-5'-phosphate: F53 (= F53), K54 (= K54), N79 (= N81), G178 (= G180), G179 (= G181), G180 (= G182), G181 (= G183), M182 (≠ L184), V233 (≠ L234), E276 (= E278), T278 (≠ A280), S306 (= S306), G307 (= G307)
7nbgDDD structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
37% identity, 95% coverage: 6:311/323 of query aligns to 5:310/310 of 7nbgDDD
- active site: K53 (= K54), S76 (= S79), E202 (= E205), A206 (≠ T209), D208 (≠ K211), G231 (= G233), L304 (= L305), S305 (= S306)
- binding calcium ion: E202 (= E205), A206 (≠ T209), D208 (≠ K211)
- binding magnesium ion: N239 (= N242)
- binding ortho-xylene: S76 (= S79), Q81 (= Q84), I96 (≠ L99), Y113 (≠ L116)
- binding pyridoxal-5'-phosphate: F52 (= F53), K53 (= K54), N78 (= N81), G177 (= G180), G178 (= G181), G179 (= G182), G180 (= G183), M181 (≠ L184), G231 (= G233), V232 (≠ L234), E275 (= E278), T277 (≠ A280), S305 (= S306), G306 (= G307)
Sites not aligning to the query:
7nbhAAA structure of human serine racemase in complex with DSiP fragment Z26781964, XChem fragment screen (see paper)
36% identity, 95% coverage: 6:312/323 of query aligns to 5:316/320 of 7nbhAAA
- active site: K53 (= K54), S81 (= S79), E207 (= E205), A211 (≠ T209), D213 (≠ K211), G236 (= G233), L309 (= L305), S310 (= S306)
- binding calcium ion: E207 (= E205), A211 (≠ T209), D213 (≠ K211)
- binding N-[(1H-benzimidazol-2-yl)methyl]furan-2-carboxamide: S81 (= S79), G85 (≠ A83), Q86 (= Q84), K111 (= K109), I115 (≠ T113), Y118 (≠ L116), D235 (= D232), P281 (= P279), N313 (= N309), V314 (≠ W310), D315 (= D311)
7nbgAAA structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
36% identity, 95% coverage: 6:312/323 of query aligns to 5:316/322 of 7nbgAAA
- active site: K53 (= K54), S81 (= S79), E207 (= E205), A211 (≠ T209), D213 (≠ K211), G236 (= G233), L309 (= L305), S310 (= S306)
- binding calcium ion: E207 (= E205), A211 (≠ T209), D213 (≠ K211)
- binding pyridoxal-5'-phosphate: F52 (= F53), K53 (= K54), N83 (= N81), G182 (= G180), G183 (= G181), G184 (= G182), G185 (= G183), M186 (≠ L184), G236 (= G233), V237 (≠ L234), T282 (≠ A280), S310 (= S306), G311 (= G307)
- binding ~{N}-[2-(2-methylphenyl)ethyl]ethanamide: S81 (= S79), G85 (≠ A83), Q86 (= Q84), I101 (≠ L99), K111 (= K109), I115 (≠ T113), Y118 (≠ L116)
7nbfAAA structure of human serine racemase in complex with DSiP fragment Z126932614, XChem fragment screen (see paper)
36% identity, 95% coverage: 6:312/323 of query aligns to 5:316/323 of 7nbfAAA
- active site: K53 (= K54), S81 (= S79), E207 (= E205), A211 (≠ T209), D213 (≠ K211), G236 (= G233), L309 (= L305), S310 (= S306)
- binding calcium ion: E207 (= E205), A211 (≠ T209), D213 (≠ K211)
- binding magnesium ion: N244 (= N242)
- binding pyridoxal-5'-phosphate: F52 (= F53), K53 (= K54), N83 (= N81), G182 (= G180), G183 (= G181), G184 (= G182), G185 (= G183), M186 (≠ L184), G236 (= G233), V237 (≠ L234), T282 (≠ A280), S310 (= S306), G311 (= G307)
- binding 2-[(methylsulfonyl)methyl]-1H-benzimidazole: H21 (≠ R22), L22 (≠ H23), T23 (= T24), P24 (= P25), L26 (= L27), T27 (≠ R28), F46 (≠ L47)
Sites not aligning to the query:
7nbdAAA structure of human serine racemase in complex with DSiP fragment Z235449082, XChem fragment screen (see paper)
36% identity, 95% coverage: 6:312/323 of query aligns to 5:316/323 of 7nbdAAA
- active site: K53 (= K54), S81 (= S79), E207 (= E205), A211 (≠ T209), D213 (≠ K211), G236 (= G233), L309 (= L305), S310 (= S306)
- binding calcium ion: E207 (= E205), A211 (≠ T209), D213 (≠ K211)
- binding [4-(1H-benzimidazol-1-yl)phenyl]methanol: W272 (≠ A270), L278 (≠ I276), V314 (≠ W310), L316 (= L312)
- binding magnesium ion: N244 (= N242)
- binding pyridoxal-5'-phosphate: F52 (= F53), K53 (= K54), N83 (= N81), G182 (= G180), G183 (= G181), G184 (= G182), G185 (= G183), M186 (≠ L184), G236 (= G233), V237 (≠ L234), E280 (= E278), T282 (≠ A280), S310 (= S306), G311 (= G307)
Sites not aligning to the query:
7nbcCCC structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
36% identity, 95% coverage: 6:312/323 of query aligns to 5:316/323 of 7nbcCCC
- active site: K53 (= K54), S81 (= S79), E207 (= E205), A211 (≠ T209), D213 (≠ K211), G236 (= G233), L309 (= L305), S310 (= S306)
- binding biphenyl-4-ylacetic acid: T78 (≠ A76), H79 (≠ T77), H84 (= H82), V148 (≠ I146), H149 (= H147), P150 (≠ G148)
- binding calcium ion: E207 (= E205), A211 (≠ T209), D213 (≠ K211)
- binding pyridoxal-5'-phosphate: F52 (= F53), K53 (= K54), N83 (= N81), G182 (= G180), G183 (= G181), G184 (= G182), G185 (= G183), M186 (≠ L184), G236 (= G233), V237 (≠ L234), T282 (≠ A280), S310 (= S306), G311 (= G307)
7nbcAAA structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
36% identity, 95% coverage: 6:312/323 of query aligns to 5:316/323 of 7nbcAAA
- active site: K53 (= K54), S81 (= S79), E207 (= E205), A211 (≠ T209), D213 (≠ K211), G236 (= G233), L309 (= L305), S310 (= S306)
- binding calcium ion: E207 (= E205), A211 (≠ T209), D213 (≠ K211)
- binding magnesium ion: N244 (= N242)
- binding pyridoxal-5'-phosphate: F52 (= F53), K53 (= K54), N83 (= N81), G182 (= G180), G183 (= G181), G184 (= G182), G185 (= G183), M186 (≠ L184), G236 (= G233), V237 (≠ L234), T282 (≠ A280), S310 (= S306), G311 (= G307)
Sites not aligning to the query:
6zspAAA serine racemase bound to atp and malonate. (see paper)
36% identity, 95% coverage: 6:312/323 of query aligns to 5:309/320 of 6zspAAA
- active site: K53 (= K54), S74 (= S79), E200 (= E205), A204 (≠ T209), D206 (≠ K211), G229 (= G233), L302 (= L305), S303 (= S306)
- binding adenosine-5'-triphosphate: S28 (≠ A29), S29 (≠ E30), I30 (≠ K31), K48 (≠ I49), T49 (= T50), Q79 (= Q84), Y111 (≠ L116), E266 (≠ K271), R267 (≠ D272), K269 (= K274), N306 (= N309)
- binding magnesium ion: E200 (= E205), A204 (≠ T209), D206 (≠ K211)
- binding malonate ion: K53 (= K54), S73 (= S78), S74 (= S79), N76 (= N81), H77 (= H82), R125 (= R130), G229 (= G233), S232 (≠ I236)
2gn2A Crystal structure of tetrameric biodegradative threonine deaminase (tdcb) from salmonella typhimurium in complex with cmp at 2.5a resolution (hexagonal form) (see paper)
42% identity, 97% coverage: 7:318/323 of query aligns to 9:321/326 of 2gn2A
- active site: K56 (= K54), A81 (≠ S79), Q207 (≠ E205), V211 (vs. gap), G213 (≠ A207), G235 (= G233), I308 (≠ L305), S309 (= S306)
- binding cytidine-5'-monophosphate: R51 (≠ I49), T52 (= T50), G53 (= G51), A114 (≠ N112), D117 (≠ A115), Y118 (≠ L116), N312 (= N309)
5cvcA Structure of maize serine racemase (see paper)
36% identity, 96% coverage: 7:315/323 of query aligns to 5:316/329 of 5cvcA
- active site: K52 (= K54), S77 (= S79), E203 (= E205), A207 (≠ T209), D209 (≠ K211), G231 (= G233), V306 (≠ L305), S307 (= S306)
- binding magnesium ion: E203 (= E205), A207 (≠ T209), D209 (≠ K211)
- binding pyridoxal-5'-phosphate: F51 (= F53), K52 (= K54), N79 (= N81), S178 (≠ G180), G179 (= G181), G180 (= G182), G181 (= G183), L232 (= L234), E275 (= E278), S307 (= S306), G308 (= G307)
Q9QZX7 Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Mus musculus (Mouse) (see paper)
37% identity, 96% coverage: 6:315/323 of query aligns to 8:322/339 of Q9QZX7
- C113 (≠ I108) modified: S-nitrosocysteine; mutation to S: Abolishes S-nitrosylation.
3hmkA Crystal structure of serine racemase (see paper)
37% identity, 96% coverage: 6:316/323 of query aligns to 6:321/321 of 3hmkA
- active site: K54 (= K54), S82 (= S79), E208 (= E205), A212 (≠ T209), D214 (≠ K211), G237 (= G233), T283 (≠ A280), L310 (= L305), S311 (= S306)
- binding manganese (ii) ion: E208 (= E205), A212 (≠ T209), D214 (≠ K211)
- binding pyridoxal-5'-phosphate: F53 (= F53), K54 (= K54), N84 (= N81), G183 (= G180), G184 (= G181), G185 (= G182), G186 (= G183), M187 (≠ L184), G237 (= G233), V238 (≠ L234), T283 (≠ A280), S311 (= S306), G312 (= G307)
2zr8A Crystal structure of modified serine racemase complexed with serine (see paper)
34% identity, 97% coverage: 5:316/323 of query aligns to 4:314/319 of 2zr8A
- active site: K53 (= K54), S78 (= S79), E204 (= E205), G208 (≠ T209), D210 (≠ K211), G232 (= G233), I303 (≠ L305), S304 (= S306)
- binding magnesium ion: E204 (= E205), G208 (≠ T209), D210 (≠ K211)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F53), K53 (= K54), S77 (= S78), S78 (= S79), N80 (= N81), H81 (= H82), P147 (≠ G148), G179 (= G180), G180 (= G181), G181 (= G182), G182 (= G183), G232 (= G233), E277 (= E278), T279 (≠ A280), S304 (= S306)
- binding serine: S78 (= S79), R129 (= R130), D231 (= D232), G232 (= G233), A233 (≠ L234), Q234 (≠ R235), T235 (≠ I236)
2zpuA Crystal structure of modified serine racemase from s.Pombe. (see paper)
34% identity, 97% coverage: 5:316/323 of query aligns to 4:314/319 of 2zpuA
- active site: K53 (= K54), S78 (= S79), E204 (= E205), G208 (≠ T209), D210 (≠ K211), G232 (= G233), I303 (≠ L305), S304 (= S306)
- binding magnesium ion: E204 (= E205), G208 (≠ T209), D210 (≠ K211)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F53), K53 (= K54), S77 (= S78), S78 (= S79), N80 (= N81), H81 (= H82), P147 (≠ G148), G179 (= G180), G180 (= G181), G181 (= G182), G182 (= G183), G232 (= G233), E277 (= E278), T279 (≠ A280), S304 (= S306)
O59791 Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 4.3.1.17; EC 4.3.1.18; EC 5.1.1.18 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
34% identity, 97% coverage: 5:316/323 of query aligns to 8:318/323 of O59791
- S82 (= S79) mutation to A: Loss of racemase activity. Reduces D-serine dehydratase activity by 99%. Slightly reduced L-serine dehydratase activity.
1wtcA Crystal structure of s.Pombe serine racemase complex with amppcp (see paper)
34% identity, 97% coverage: 5:316/323 of query aligns to 3:313/318 of 1wtcA
- active site: K52 (= K54), S77 (= S79), E203 (= E205), G207 (≠ T209), D209 (≠ K211), G231 (= G233), I302 (≠ L305), S303 (= S306)
- binding phosphomethylphosphonic acid adenylate ester: N20 (≠ R22), K47 (≠ I49), M48 (≠ T50), A109 (≠ E111), A110 (≠ N112), Y114 (≠ L116)
- binding magnesium ion: E203 (= E205), G207 (≠ T209), D209 (≠ K211)
- binding pyridoxal-5'-phosphate: F51 (= F53), K52 (= K54), N79 (= N81), G178 (= G180), G179 (= G181), G180 (= G182), G181 (= G183), G231 (= G233), E276 (= E278), T278 (≠ A280), S303 (= S306)
1v71A Crystal structure of s.Pombe serine racemase
34% identity, 97% coverage: 5:316/323 of query aligns to 3:313/318 of 1v71A
- active site: K52 (= K54), S77 (= S79), E203 (= E205), G207 (≠ T209), D209 (≠ K211), G231 (= G233), I302 (≠ L305), S303 (= S306)
- binding magnesium ion: E203 (= E205), G207 (≠ T209), D209 (≠ K211)
- binding pyridoxal-5'-phosphate: F51 (= F53), K52 (= K54), N79 (= N81), G178 (= G180), G179 (= G181), G180 (= G182), G181 (= G183), G231 (= G233), E276 (= E278), T278 (≠ A280), S303 (= S306), G304 (= G307)
A4F2N8 L-threo-3-hydroxyaspartate ammonia-lyase; L-threo-3-hydroxyaspartate dehydratase; L-THA DH; EC 4.3.1.16 from Pseudomonas sp. (see paper)
32% identity, 97% coverage: 6:318/323 of query aligns to 5:316/319 of A4F2N8
- K53 (= K54) mutation to A: Loss of enzymatic activity.
Query Sequence
>SMa1872 FitnessBrowser__Smeli:SMa1872
MRNYPTIQDIREARERLKPHVRHTPLLRAEKIEKAAGCQLYLKPETLQITGAFKIRGALN
KALSLSREEIANGIIATSSGNHAQGLSYAAKMLGVKVILVLPVTTPKIKIENTKALGAEV
ILFDGDNAARWKKVYEIAEGNKYAVIHGFEDPVVMAGQGTIGCEILEDLDDVDTVIVPLG
GGGLISGIATAIKETKPSVRVIGAEPALTPKYFHSRVNKERTSLPLKNTIADGLRISVPG
QNPYPIIEKYVDEIVLVEDEHIIAGMRALAKDAKLIAEPAASIGVGALLAGIIDVKLDEK
VCAVLSGGNWDLRDLAAIYNVAG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory