Comparing SMa2000 FitnessBrowser__Smeli:SMa2000 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4rsmA Crystal structure of carbohydrate transporter msmeg_3599 from mycobacterium smegmatis str. Mc2 155, target efi-510970, in complex with d-threitol (see paper)
28% identity, 73% coverage: 59:321/358 of query aligns to 12:268/315 of 4rsmA
Sites not aligning to the query:
A0QYB5 D-threitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
28% identity, 73% coverage: 59:321/358 of query aligns to 44:300/349 of A0QYB5
Sites not aligning to the query:
4rs3A Crystal structure of carbohydrate transporter a0qyb3 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with xylitol (see paper)
29% identity, 63% coverage: 95:321/358 of query aligns to 38:267/315 of 4rs3A
Sites not aligning to the query:
5hkoA Crystal structure of abc transporter solute binding protein msmeg_3598 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with l-sorbitol
29% identity, 63% coverage: 95:321/358 of query aligns to 38:267/314 of 5hkoA
Sites not aligning to the query:
A0QYB3 Xylitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
29% identity, 63% coverage: 95:321/358 of query aligns to 71:300/349 of A0QYB3
Sites not aligning to the query:
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
27% identity, 46% coverage: 89:254/358 of query aligns to 32:198/274 of 2ioyA
Sites not aligning to the query:
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
32% identity, 44% coverage: 106:261/358 of query aligns to 53:215/287 of 5dteB
Sites not aligning to the query:
4pe6B Crystal structure of abc transporter solute binding protein from thermobispora bispora dsm 43833
29% identity, 68% coverage: 75:318/358 of query aligns to 24:269/324 of 4pe6B
Sites not aligning to the query:
P39325 Galactofuranose-binding protein YtfQ from Escherichia coli (strain K12) (see 2 papers)
28% identity, 58% coverage: 54:261/358 of query aligns to 23:235/318 of P39325
Sites not aligning to the query:
2vk2A Crystal structure of a galactofuranose binding protein (see paper)
28% identity, 58% coverage: 54:261/358 of query aligns to 1:213/296 of 2vk2A
Sites not aligning to the query:
4zjpA Structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose
26% identity, 62% coverage: 89:310/358 of query aligns to 34:255/270 of 4zjpA
Sites not aligning to the query:
2x7xA Fructose binding periplasmic domain of hybrid two component system bt1754 (see paper)
25% identity, 60% coverage: 95:310/358 of query aligns to 39:258/301 of 2x7xA
Sites not aligning to the query:
1dbpA Identical mutations at corresponding positions in two homologous proteins with non-identical effects (see paper)
22% identity, 70% coverage: 67:316/358 of query aligns to 13:261/271 of 1dbpA
7e7mC Crystal structure analysis of the streptococcus agalactiae ribose binding protein rbsb
26% identity, 62% coverage: 94:315/358 of query aligns to 45:266/284 of 7e7mC
Sites not aligning to the query:
5ocpA The periplasmic binding protein component of the arabinose abc transporter from shewanella sp. Ana-3 bound to alpha and beta-l- arabinofuranose
27% identity, 71% coverage: 57:309/358 of query aligns to 3:261/302 of 5ocpA
4yo7A Crystal structure of an abc transporter solute binding protein (ipr025997) from bacillus halodurans c-125 (bh2323, target efi- 511484) with bound myo-inositol
27% identity, 48% coverage: 89:261/358 of query aligns to 38:212/287 of 4yo7A
Sites not aligning to the query:
6hyhA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with beta-d-fucofuranose (see paper)
27% identity, 47% coverage: 94:261/358 of query aligns to 38:212/304 of 6hyhA
Sites not aligning to the query:
6hbmA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with alpha-l-arabinofuranose (see paper)
27% identity, 47% coverage: 94:261/358 of query aligns to 38:212/304 of 6hbmA
Sites not aligning to the query:
6hbdA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with beta-d-galactofuranose (see paper)
27% identity, 47% coverage: 94:261/358 of query aligns to 39:213/305 of 6hbdA
Sites not aligning to the query:
5br1A Crystal structure of an abc transporter solute binding protein (ipr025997) from agrobacterium vitis s4 (avi_5305, target efi-511224) with bound alpha-d-galactosamine (see paper)
29% identity, 45% coverage: 93:254/358 of query aligns to 37:204/320 of 5br1A
Sites not aligning to the query:
>SMa2000 FitnessBrowser__Smeli:SMa2000
MSTIIRKIRASVLLAGVFFATNSFAQEVPLLEGVTTRAENNPTVEEGKYKKDAPWVIGMS
SFGVNANTWTVQVAHEAQAAADNDKRITKFILLDAGFDQKKQVADIEDLIAQKVDAIIVQ
PVTSTSANASIEKAVAAGIPVVLHTGRIESEAYTTEIQGGAEHFGKVMGDFLVKELGGKG
NIWVLRGLAGHPEDTNRYNGLKQSLEGTEIKIAAEEHGDWQYDKAKKVCETLYLSDPNVD
GIWSSGADMTRACVDVFKQFGSPIPPISGEGNNGFFGQWIADGFKSISSEYSPAQGAAGI
RAAVALLEGKALHKHYDYNPPGWDLEKVKKYYRDDLSANVWWPSELSEEQLKEFYAKQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory