SitesBLAST
Comparing SMa2137 FitnessBrowser__Smeli:SMa2137 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
42% identity, 98% coverage: 7:323/324 of query aligns to 1:321/334 of 5aovA
- active site: L100 (= L106), R241 (= R243), D265 (= D267), E270 (= E272), H288 (= H290)
- binding glyoxylic acid: M52 (≠ T58), L53 (≠ V59), L53 (≠ V59), Y74 (≠ F80), A75 (≠ G81), V76 (= V82), G77 (= G83), R241 (= R243), H288 (= H290)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (= V82), T104 (= T110), F158 (≠ M160), G159 (= G161), R160 (= R162), I161 (= I163), S180 (≠ D183), R181 (≠ S184), A211 (≠ H213), V212 (≠ C214), P213 (= P215), T218 (≠ N220), I239 (≠ T241), A240 (= A242), R241 (= R243), H288 (= H290), G290 (= G292)
6biiA Crystal structure of pyrococcus yayanosii glyoxylate hydroxypyruvate reductase in complex with NADP and malonate (re-refinement of 5aow) (see paper)
42% identity, 98% coverage: 8:323/324 of query aligns to 1:320/332 of 6biiA
- active site: L99 (= L106), R240 (= R243), D264 (= D267), E269 (= E272), H287 (= H290)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V75 (= V82), T103 (= T110), G156 (= G159), F157 (≠ M160), G158 (= G161), R159 (= R162), I160 (= I163), A179 (vs. gap), R180 (≠ D183), S181 (= S184), K183 (≠ S186), V211 (≠ C214), P212 (= P215), E216 (= E219), T217 (≠ N220), V238 (≠ T241), A239 (= A242), R240 (= R243), D264 (= D267), H287 (= H290), G289 (= G292)
O58320 Glyoxylate reductase; EC 1.1.1.26 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
43% identity, 98% coverage: 7:323/324 of query aligns to 1:321/334 of O58320
2dbqA Crystal structure of glyoxylate reductase (ph0597) from pyrococcus horikoshii ot3, complexed with NADP (i41) (see paper)
43% identity, 98% coverage: 7:323/324 of query aligns to 1:321/333 of 2dbqA
- active site: L100 (= L106), R241 (= R243), D265 (= D267), E270 (= E272), H288 (= H290)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (= V82), T104 (= T110), L158 (≠ M160), G159 (= G161), R160 (= R162), I161 (= I163), S180 (≠ D183), R181 (≠ S184), T182 (≠ H185), A211 (≠ H213), V212 (≠ C214), P213 (= P215), T218 (≠ N220), I239 (≠ T241), A240 (= A242), R241 (= R243), D265 (= D267), H288 (= H290), G290 (= G292)
Q9UBQ7 Glyoxylate reductase/hydroxypyruvate reductase; EC 1.1.1.79; EC 1.1.1.81 from Homo sapiens (Human) (see paper)
37% identity, 99% coverage: 1:321/324 of query aligns to 1:324/328 of Q9UBQ7
2gcgA Ternary crystal structure of human glyoxylate reductase/hydroxypyruvate reductase (see paper)
37% identity, 96% coverage: 10:321/324 of query aligns to 4:320/324 of 2gcgA
- active site: L103 (= L106), R241 (= R243), D265 (= D267), E270 (= E272), H289 (= H290)
- binding (2r)-2,3-dihydroxypropanoic acid: L55 (≠ V59), S78 (≠ G81), V79 (= V82), G80 (= G83), R241 (= R243), H289 (= H290)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V79 (= V82), T107 (= T110), G156 (= G159), G158 (= G161), I160 (= I163), G180 (≠ S184), R181 (≠ H185), R184 (≠ A188), C212 (= C214), S213 (≠ P215), T218 (≠ N220), I239 (≠ T241), R241 (= R243), D265 (= D267), H289 (= H290), G291 (= G292)
6ih6A Phosphite dehydrogenase mutant i151r/p176r/m207a from ralstonia sp. 4506 in complex with non-natural cofactor nicotinamide cytosine dinucleotide
36% identity, 98% coverage: 7:323/324 of query aligns to 1:326/330 of 6ih6A
- binding [[(2S,3S,4R,5S)-5-(3-aminocarbonylpyridin-1-ium-1-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2S,3S,4R,5S)-5-(4-azanyl-2-oxidanylidene-pyrimidin-1-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl hydrogen phosphate: T104 (= T110), R151 (≠ I158), G154 (= G161), A155 (≠ R162), V156 (≠ I163), D175 (= D183), A207 (≠ H213), V208 (≠ C214), P209 (= P215), T214 (≠ N220), A235 (≠ T241), C236 (≠ A242), R237 (= R243)
5v6qB Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADP and malonate (see paper)
37% identity, 95% coverage: 8:315/324 of query aligns to 3:302/319 of 5v6qB
- active site: L96 (= L106), R230 (= R243), D254 (= D267), E259 (= E272), H277 (= H290)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V72 (= V82), V100 (≠ T110), F148 (≠ I158), L150 (≠ M160), G151 (= G161), R152 (= R162), I153 (= I163), T172 (≠ D183), R173 (≠ S184), V201 (≠ C214), P202 (= P215), S206 (≠ E219), T207 (≠ N220), V228 (≠ T241), G229 (≠ A242), R230 (= R243), H277 (= H290), A279 (≠ G292)
5v7nA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADP and 2-keto-d-gluconic acid (see paper)
37% identity, 95% coverage: 8:315/324 of query aligns to 2:301/319 of 5v7nA
- active site: L95 (= L106), R229 (= R243), D253 (= D267), E258 (= E272), H276 (= H290)
- binding 2-keto-D-gluconic acid: G70 (= G81), V71 (= V82), G72 (= G83), R229 (= R243), H276 (= H290), S279 (= S293), R285 (= R299)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V71 (= V82), V99 (≠ T110), L149 (≠ M160), G150 (= G161), R151 (= R162), I152 (= I163), T171 (≠ D183), R172 (≠ S184), V200 (≠ C214), P201 (= P215), S205 (≠ E219), T206 (≠ N220), V227 (≠ T241), G228 (≠ A242), R229 (= R243), H276 (= H290), A278 (≠ G292)
5j23A Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with 2'-phospho-adp-ribose (see paper)
37% identity, 95% coverage: 8:315/324 of query aligns to 1:300/318 of 5j23A
- active site: L94 (= L106), R228 (= R243), D252 (= D267), E257 (= E272), H275 (= H290)
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4r,5r)-3,4,5-trihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: V70 (= V82), L148 (≠ M160), G149 (= G161), R150 (= R162), I151 (= I163), T170 (≠ D183), R171 (≠ S184), P200 (= P215), S204 (≠ E219), T205 (≠ N220), R228 (= R243)
5v7gA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADPH and oxalate (see paper)
37% identity, 95% coverage: 8:315/324 of query aligns to 1:300/317 of 5v7gA
- active site: L94 (= L106), R228 (= R243), D252 (= D267), E257 (= E272), H275 (= H290)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V70 (= V82), V98 (≠ T110), F146 (≠ I158), L148 (≠ M160), G149 (= G161), R150 (= R162), I151 (= I163), T170 (≠ D183), R171 (≠ S184), V199 (≠ C214), P200 (= P215), S204 (≠ E219), T205 (≠ N220), V226 (≠ T241), G227 (≠ A242), R228 (= R243), H275 (= H290), A277 (≠ G292)
- binding oxalate ion: G69 (= G81), V70 (= V82), G71 (= G83), R228 (= R243), H275 (= H290)
3bazA Structure of hydroxyphenylpyruvate reductase from coleus blumei in complex with NADP+ (see paper)
37% identity, 90% coverage: 25:317/324 of query aligns to 14:304/311 of 3bazA
- active site: L98 (= L106), R230 (= R243), A251 (= A264), D254 (= D267), E259 (= E272), H277 (= H290)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V74 (= V82), G149 (= G159), L150 (≠ M160), G151 (= G161), R152 (= R162), I153 (= I163), S172 (≠ D183), R173 (≠ S184), S174 (≠ H185), C201 (= C214), P202 (= P215), T207 (≠ N220), I228 (≠ T241), G229 (≠ A242), R230 (= R243), D254 (= D267), H277 (= H290), G279 (= G292)
Q65CJ7 Hydroxyphenylpyruvate reductase; HPPR; EC 1.1.1.237 from Plectranthus scutellarioides (Coleus) (Solenostemon scutellarioides) (see paper)
37% identity, 90% coverage: 25:317/324 of query aligns to 16:306/313 of Q65CJ7
3ddnB Crystal structure of hydroxypyruvic acid phosphate bound d-3- phosphoglycerate dehydrogenase in mycobacterium tuberculosis (see paper)
39% identity, 87% coverage: 41:323/324 of query aligns to 32:311/525 of 3ddnB
3dc2A Crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis (see paper)
39% identity, 87% coverage: 41:323/324 of query aligns to 31:310/526 of 3dc2A
Sites not aligning to the query:
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
32% identity, 87% coverage: 38:318/324 of query aligns to 34:311/533 of O43175
- T78 (≠ V82) binding
- R135 (≠ P142) to W: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606949
- RI 155:156 (= RI 162:163) binding
- D175 (= D183) binding
- T207 (≠ C214) binding
- CAR 234:236 (≠ TAR 241:243) binding
- D260 (= D267) binding
- V261 (= V268) to M: in PHGDHD; results in a four-fold decrease in substrate affinity and a slight increase in maximal enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs267606947
- HLGA 283:286 (≠ HLGS 290:293) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 373 A → T: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs201553627
- 377 G → S: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606948
- 425 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907988
- 490 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907987
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
33% identity, 83% coverage: 38:306/324 of query aligns to 28:293/297 of 6rj3A
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
33% identity, 83% coverage: 38:306/324 of query aligns to 29:294/302 of 7ewhA
- binding (3beta)-O~3~-[(2R)-2,6-dihydroxy-2-(2-methoxy-2-oxoethyl)-6-methylheptanoyl]cephalotaxine: L146 (≠ I158), G147 (= G159), L148 (≠ M160), G149 (= G161), R150 (= R162), I151 (= I163), G152 (= G164), D170 (= D183), H201 (= H213), T202 (≠ C214), P203 (= P215)
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
33% identity, 83% coverage: 38:306/324 of query aligns to 29:294/302 of 6rihA
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
33% identity, 83% coverage: 38:306/324 of query aligns to 29:294/303 of 6plgA
Query Sequence
>SMa2137 FitnessBrowser__Smeli:SMa2137
MRRDRIVKPKVIVTRRWPTEVEDRLTAEFDTRLNETDQPYDRRELRAALEEADAVLPTVT
DKISADMLEGGIRAKILGNFGVGFNHIDTAAATKVGLVVTNTPGVLTDATADLAMTLLLM
CARRAGEGERELRAGKWTGWRPTHLCGSHVTGKTVGIIGMGRIGQAVARRCHFGFGMDVV
FFDSHSIAGLDVPARQLPSVDDVLATADFVSLHCPGGGENYHLIDDDRLACMKWSAFLIN
TARGDVVDEHALVRALETRRIAGAGLDVFEGEPRVPGRLAERQDVVLLPHLGSATKETRV
AMGMRVIENLKAFFSGRSPPDAVC
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory