Comparing SMa2145 FitnessBrowser__Smeli:SMa2145 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1worA Crystal structure of t-protein of the glycine cleavage system (see paper)
31% identity, 94% coverage: 20:414/418 of query aligns to 1:362/362 of 1worA
1wopA Crystal structure of t-protein of the glycine cleavage system (see paper)
31% identity, 94% coverage: 20:414/418 of query aligns to 1:362/362 of 1wopA
1wooA Crystal structure of t-protein of the glycine cleavage system (see paper)
31% identity, 94% coverage: 20:414/418 of query aligns to 1:362/362 of 1wooA
A0A1J1EM40 Sesamin methylene transferase; Sesamin-metabolizing enzyme; THF-dependent sesamin/sesamin-monocatechol methylenetransferase; EC 2.1.5.1 from Sinomonas sp. (strain No.22) (see paper)
29% identity, 86% coverage: 56:415/418 of query aligns to 37:433/452 of A0A1J1EM40
Sites not aligning to the query:
1pj7A Structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folinic acid (see paper)
29% identity, 88% coverage: 48:415/418 of query aligns to 475:823/827 of 1pj7A
Sites not aligning to the query:
1pj6A Crystal structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folic acid (see paper)
29% identity, 88% coverage: 48:415/418 of query aligns to 476:824/828 of 1pj6A
Sites not aligning to the query:
Q9AGP8 Dimethylglycine oxidase; DMGO; EC 1.5.3.10 from Arthrobacter globiformis (see 2 papers)
29% identity, 88% coverage: 48:415/418 of query aligns to 478:826/830 of Q9AGP8
Sites not aligning to the query:
3tfjA Dmsp-dependent demethylase from p. Ubique - with cofactor thf (see paper)
24% identity, 93% coverage: 20:409/418 of query aligns to 12:368/369 of 3tfjA
3tfiA Dmsp-dependent demethylase from p. Ubique - with substrate dmsp (see paper)
24% identity, 93% coverage: 20:409/418 of query aligns to 12:368/369 of 3tfiA
Q4FP21 Dimethylsulfonioproprionate demethylase DmdA; EC 2.1.1.269 from Pelagibacter ubique (strain HTCC1062) (see paper)
24% identity, 93% coverage: 20:409/418 of query aligns to 12:368/369 of Q4FP21
3gsiA Crystal structure of d552a dimethylglycine oxidase mutant of arthrobacter globiformis in complex with tetrahydrofolate (see paper)
29% identity, 88% coverage: 48:415/418 of query aligns to 475:823/827 of 3gsiA
Sites not aligning to the query:
Q50LF0 Sarcosine oxidase subunit alpha; Sarcosine oxidase subunit A; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit alpha; Tetrameric sarcosine oxidase subunit alpha; TSOX subunit alpha; EC 1.5.3.24 from Corynebacterium sp. (strain U-96) (see 2 papers)
29% identity, 62% coverage: 56:314/418 of query aligns to 616:870/965 of Q50LF0
Sites not aligning to the query:
3ad7A Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with methylthio acetate (see paper)
29% identity, 62% coverage: 56:314/418 of query aligns to 615:869/963 of 3ad7A
Sites not aligning to the query:
1vrqA Crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with folinic acid (see paper)
29% identity, 62% coverage: 56:314/418 of query aligns to 615:869/963 of 1vrqA
Sites not aligning to the query:
2gagA Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution (see paper)
30% identity, 63% coverage: 56:318/418 of query aligns to 616:875/965 of 2gagA
Sites not aligning to the query:
Q46337 Sarcosine oxidase subunit alpha; Sarcosine oxidase subunit A; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit alpha; Tetrameric sarcosine oxidase subunit alpha; TSOX subunit alpha; EC 1.5.3.24 from Corynebacterium sp. (strain P-1) (see 2 papers)
29% identity, 62% coverage: 56:314/418 of query aligns to 618:872/967 of Q46337
Sites not aligning to the query:
Q9UI17 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Homo sapiens (Human) (see 4 papers)
26% identity, 80% coverage: 55:389/418 of query aligns to 520:831/866 of Q9UI17
Sites not aligning to the query:
4pabB Crystal structure of the precursor form of rat dmgdh complexed with tetrahydrofolate (see paper)
25% identity, 80% coverage: 55:389/418 of query aligns to 476:787/824 of 4pabB
Sites not aligning to the query:
Q63342 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Rattus norvegicus (Rat) (see 2 papers)
25% identity, 80% coverage: 55:389/418 of query aligns to 513:824/857 of Q63342
Sites not aligning to the query:
3a8iA Crystal structure of et-ehred-5-ch3-thf complex (see paper)
27% identity, 80% coverage: 50:382/418 of query aligns to 29:335/363 of 3a8iA
>SMa2145 FitnessBrowser__Smeli:SMa2145
MDDIKFTTGLTTAQGARVAFRGTPFVERTAPLNQNALWMRWDRNMVVDAYSDMVAELSAI
RTAVAMGDMSPLSKYVIAGPDAEAMMDRLIPRDIRKLQVGQIYYAPWCDENGYVVGDGLV
FRMDENTFRVSADPGFTWWRQHAEGLDLQVTDITDTYGILTLQGPRSREVLEAATEAGFQ
ELPFSRLAVVTIAGRQVEILRQGFTGEHGYELWVKAEDGPTVWDAVEAAGRPFSIRPAGA
WALDVARLEAGLLIVGYDYTSAGPDHGGAGIQASGKFRASPFDLGLGRLVDFKKSDFIGR
TALERLSKYGQHRQLVGLEIDWKQIAGTGLESEEPGNLRRVRWYPVPVFGGSVEIGHASS
VAWSPTLRKLIGFGHLQQAFGEIGTQVTLRWEDDGTTRDVAARVVALPFHSLRRTASN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory