Comparing SMa2195 FitnessBrowser__Smeli:SMa2195 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3c4jA Abc protein artp in complex with atp-gamma-s
55% identity, 98% coverage: 5:253/254 of query aligns to 3:241/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
55% identity, 98% coverage: 5:253/254 of query aligns to 3:241/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
55% identity, 98% coverage: 5:253/254 of query aligns to 3:241/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
55% identity, 98% coverage: 5:253/254 of query aligns to 3:241/242 of 2oljA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
56% identity, 98% coverage: 4:253/254 of query aligns to 1:239/241 of 4u00A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
55% identity, 98% coverage: 5:253/254 of query aligns to 1:239/240 of 4ymuJ
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
52% identity, 95% coverage: 11:251/254 of query aligns to 8:250/258 of 1b0uA
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
52% identity, 95% coverage: 11:251/254 of query aligns to 12:254/258 of P02915
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
41% identity, 98% coverage: 5:254/254 of query aligns to 1:246/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
40% identity, 98% coverage: 5:254/254 of query aligns to 2:247/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
40% identity, 98% coverage: 5:254/254 of query aligns to 2:247/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
40% identity, 98% coverage: 5:254/254 of query aligns to 2:247/344 of 6cvlD
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
38% identity, 95% coverage: 9:250/254 of query aligns to 30:263/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
38% identity, 95% coverage: 9:250/254 of query aligns to 30:263/382 of 7aheC
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
38% identity, 92% coverage: 9:242/254 of query aligns to 30:255/260 of 7ahdC
Sites not aligning to the query:
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
36% identity, 91% coverage: 11:241/254 of query aligns to 12:234/375 of 2d62A
1g291 Malk (see paper)
37% identity, 91% coverage: 11:242/254 of query aligns to 9:232/372 of 1g291
Sites not aligning to the query:
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
41% identity, 84% coverage: 17:229/254 of query aligns to 20:222/650 of 5ws4A
P0AAH0 Phosphate import ATP-binding protein PstB; ABC phosphate transporter; Phosphate-transporting ATPase; EC 7.3.2.1 from Escherichia coli (strain K12) (see paper)
36% identity, 93% coverage: 15:251/254 of query aligns to 20:253/257 of P0AAH0
Sites not aligning to the query:
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
35% identity, 90% coverage: 9:236/254 of query aligns to 8:225/230 of 6z4wA
>SMa2195 FitnessBrowser__Smeli:SMa2195
MSHPMIVFDRVSKSYGSMTVLNDINLEIATGEVISLIGPSGSGKSTLLRCVNHLERIERG
SITVDGELIGYRRVGNLAHELPEKLVARQRAGIGMVFQNFNLFGHKTALENVIEAPVHVR
GLARRDAEAQATALLERVGLADKMQSYPRMLSGGQQQRVAIARALAMKPKVLLFDEPTSA
LDPELVGEVLDVMRSLAAEGLTMMVVTHEMSFAREVCNRIAFMQAGEIVECGAPSEIFDK
PAFQRTRSFLSKVH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory