SitesBLAST
Comparing SMa2211 FitnessBrowser__Smeli:SMa2211 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7egvA Acetolactate synthase from trichoderma harzianum with inhibitor harzianic acid (see paper)
28% identity, 96% coverage: 2:543/566 of query aligns to 7:551/590 of 7egvA
- active site: Y28 (≠ V23), G30 (= G25), G31 (≠ E26), A32 (≠ S27), I33 (≠ F28), E54 (= E50), T77 (= T73), F116 (= F112), Q117 (≠ M113), K166 (≠ E162), E220 (= E219), M256 (≠ I255), V283 (≠ N282), V400 (= V393), L425 (≠ I416), G426 (= G418), M428 (= M420), Q483 (≠ Y475), M485 (≠ T477), V486 (≠ I478), W489 (≠ H481), L511 (= L503), G516 (= G508), I517 (≠ A509)
- binding flavin-adenine dinucleotide: R156 (= R152), G209 (= G209), Q210 (vs. gap), G211 (= G210), T236 (= T235), L237 (≠ F236), H238 (≠ R237), G276 (≠ N275), S277 (≠ D276), R278 (≠ A277), D280 (≠ S279), R282 (≠ V281), V283 (≠ N282), E309 (vs. gap), I310 (≠ V307), D328 (= D327), V329 (≠ N328), M405 (≠ T398), G423 (= G414), G424 (≠ P415)
- binding (2S)-3-methyl-2-[[(2S,4R)-1-methyl-4-[(2E,4E)-octa-2,4-dienoyl]-3,5-bis(oxidanylidene)pyrrolidin-2-yl]methyl]-2-oxidanyl-butanoic acid: F493 (≠ R485), Y494 (≠ L486)
- binding magnesium ion: D453 (= D445), N480 (= N472), E482 (≠ L474)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: P29 (= P24), E54 (= E50), Q117 (≠ M113), V400 (= V393), G401 (= G394), Q402 (≠ A395), H403 (≠ Y396), G426 (= G418), M428 (= M420), D453 (= D445), A454 (≠ G446), S455 (≠ C447), E482 (≠ L474), Q483 (≠ Y475), G484 (= G476), M485 (≠ T477), V486 (≠ I478)
4rjkF Acetolactate synthase from bacillus subtilis bound to lthdp - crystal form ii (see paper)
29% identity, 95% coverage: 2:541/566 of query aligns to 1:532/552 of 4rjkF
- binding magnesium ion: D437 (= D445), D464 (≠ N472), T466 (≠ L474)
- binding pyruvic acid: A25 (≠ E26), K26 (≠ S27)
- binding thiamine diphosphate: P23 (= P24), E47 (= E50), P73 (= P76), G385 (= G394), S386 (≠ A395), H387 (≠ Y396), Q410 (vs. gap), L412 (vs. gap), G436 (= G444), D437 (= D445), G438 (= G446), G439 (≠ C447), T466 (≠ L474), Y467 (= Y475), D468 (≠ G476), M469 (≠ T477), V470 (≠ I478)
Sites not aligning to the query:
4rjkG Acetolactate synthase from bacillus subtilis bound to lthdp - crystal form ii (see paper)
29% identity, 95% coverage: 2:541/566 of query aligns to 1:532/553 of 4rjkG
- binding magnesium ion: D437 (= D445), D464 (≠ N472), T466 (≠ L474)
- binding 3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-carboxy-1-hydroxyethyl)-5-(2-{[hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-4-methyl-1,3-thiazol-3-ium: E47 (= E50), Q110 (≠ M113)
- binding thiamine diphosphate: I384 (≠ V393), G385 (= G394), S386 (≠ A395), H387 (≠ Y396), Q410 (vs. gap), L412 (vs. gap), G436 (= G444), D437 (= D445), G438 (= G446), G439 (≠ C447), T466 (≠ L474), Y467 (= Y475), D468 (≠ G476), M469 (≠ T477), V470 (≠ I478)
Sites not aligning to the query:
4rjiC Acetolactate synthase from bacillus subtilis bound to thdp - crystal form i (see paper)
29% identity, 95% coverage: 2:541/566 of query aligns to 2:533/555 of 4rjiC
- binding magnesium ion: D438 (= D445), D465 (≠ N472), T467 (≠ L474)
- binding thiamine diphosphate: P24 (= P24), E48 (= E50), P74 (= P76), S387 (≠ A395), H388 (≠ Y396), Q411 (vs. gap), G437 (= G444), D438 (= D445), G439 (= G446), G440 (≠ C447), T467 (≠ L474), Y468 (= Y475), D469 (≠ G476), M470 (≠ T477), V471 (≠ I478)
Sites not aligning to the query:
6deoA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide iodomuron methyl (see paper)
27% identity, 95% coverage: 4:541/566 of query aligns to 12:552/593 of 6deoA
- active site: Y31 (≠ V23), G33 (= G25), G34 (≠ E26), A35 (≠ S27), I36 (≠ F28), E57 (= E50), T80 (= T73), F119 (= F112), Q120 (≠ M113), E121 (≠ S114), K169 (≠ E162), K224 (≠ E219), M260 (≠ I255), V287 (≠ N282), V403 (= V393), L428 (vs. gap), G429 (= G418), M431 (= M420), D456 (= D445), N483 (= N472), E485 (≠ L474), Q486 (≠ Y475), M488 (≠ T477), V489 (≠ I478), W492 (≠ H481), L514 (= L503), N519 (≠ G508), V520 (≠ A509)
- binding flavin-adenine dinucleotide: R159 (= R152), G213 (= G209), A214 (vs. gap), G215 (= G210), N218 (≠ W213), T240 (= T235), L241 (≠ F236), Q242 (≠ R237), L258 (≠ I253), G280 (≠ N275), A281 (≠ D276), R282 (≠ A277), D284 (≠ S279), R286 (≠ V281), V287 (≠ N282), E313 (≠ M308), I314 (≠ P309), N318 (≠ D313), D332 (= D327), V333 (≠ N328), M408 (≠ T398), G426 (≠ I416)
- binding methyl 2-{[(4-iodo-6-methoxypyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: M260 (≠ I255), D285 (= D280), R286 (≠ V281), M488 (≠ T477), W492 (≠ H481)
- binding magnesium ion: D456 (= D445), N483 (= N472), E485 (≠ L474)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V403 (= V393), G404 (= G394), Q405 (≠ A395), H406 (≠ Y396), G429 (= G418), M431 (= M420), G455 (= G444), D456 (= D445), A457 (≠ G446), S458 (≠ C447), M461 (= M450), N483 (= N472), E485 (≠ L474), Q486 (≠ Y475), G487 (= G476), M488 (≠ T477), V489 (≠ I478)
6derA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide metosulam (see paper)
27% identity, 95% coverage: 4:541/566 of query aligns to 16:559/600 of 6derA
- active site: Y35 (≠ V23), G37 (= G25), G38 (≠ E26), A39 (≠ S27), I40 (≠ F28), E61 (= E50), T84 (= T73), F123 (= F112), Q124 (≠ M113), E125 (≠ S114), K173 (≠ E162), K231 (≠ E219), M267 (≠ I255), V294 (≠ N282), V410 (= V393), L435 (vs. gap), G436 (= G418), M438 (= M420), D463 (= D445), N490 (= N472), E492 (≠ L474), Q493 (≠ Y475), M495 (≠ T477), V496 (≠ I478), W499 (≠ H481), L521 (= L503), N526 (≠ G508), V527 (≠ A509)
- binding flavin-adenine dinucleotide: R163 (= R152), G220 (= G209), A221 (vs. gap), G222 (= G210), N225 (≠ W213), T247 (= T235), L248 (≠ F236), Q249 (≠ R237), L265 (≠ I253), H268 (≠ G256), G287 (≠ N275), A288 (≠ D276), R289 (≠ A277), D291 (≠ S279), R293 (≠ V281), V294 (≠ N282), E320 (≠ M308), I321 (≠ P309), N325 (≠ D313), G338 (≠ A326), D339 (= D327), V340 (≠ N328), Q414 (≠ A397), M415 (≠ T398), G433 (≠ I416)
- binding Metosulam: R293 (≠ V281), M495 (≠ T477), W499 (≠ H481)
- binding magnesium ion: D463 (= D445), N490 (= N472), E492 (≠ L474)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V410 (= V393), G411 (= G394), Q412 (≠ A395), H413 (≠ Y396), G436 (= G418), M438 (= M420), G462 (= G444), D463 (= D445), A464 (≠ G446), S465 (≠ C447), N490 (= N472), E492 (≠ L474), Q493 (≠ Y475), G494 (= G476), M495 (≠ T477), V496 (≠ I478)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V410 (= V393), G411 (= G394), Q412 (≠ A395), H413 (≠ Y396), G436 (= G418), M438 (= M420), G462 (= G444), D463 (= D445), A464 (≠ G446), S465 (≠ C447), M468 (= M450), N490 (= N472), E492 (≠ L474), Q493 (≠ Y475), G494 (= G476), V496 (≠ I478)
Sites not aligning to the query:
6denA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide iodomuron ethyl (see paper)
27% identity, 95% coverage: 4:541/566 of query aligns to 16:558/599 of 6denA
- active site: Y35 (≠ V23), G37 (= G25), G38 (≠ E26), A39 (≠ S27), I40 (≠ F28), E61 (= E50), T84 (= T73), F123 (= F112), Q124 (≠ M113), E125 (≠ S114), K173 (≠ E162), K230 (≠ E219), M266 (≠ I255), V293 (≠ N282), V409 (= V393), L434 (vs. gap), G435 (= G418), M437 (= M420), D462 (= D445), N489 (= N472), E491 (≠ L474), Q492 (≠ Y475), M494 (≠ T477), V495 (≠ I478), W498 (≠ H481), L520 (= L503), N525 (≠ G508), V526 (≠ A509)
- binding flavin-adenine dinucleotide: R163 (= R152), G219 (= G209), A220 (vs. gap), G221 (= G210), N224 (≠ W213), T246 (= T235), L247 (≠ F236), Q248 (≠ R237), L264 (≠ I253), G286 (≠ N275), A287 (≠ D276), R288 (≠ A277), D290 (≠ S279), R292 (≠ V281), V293 (≠ N282), E319 (≠ M308), I320 (≠ P309), N324 (≠ D313), D338 (= D327), V339 (≠ N328), M414 (≠ T398), G432 (≠ I416)
- binding ethyl 2-{[(4-iodo-6-methoxypyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: M266 (≠ I255), D291 (= D280), R292 (≠ V281), W498 (≠ H481)
- binding magnesium ion: D462 (= D445), N489 (= N472), E491 (≠ L474)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V409 (= V393), G410 (= G394), Q411 (≠ A395), H412 (≠ Y396), G435 (= G418), M437 (= M420), G461 (= G444), D462 (= D445), A463 (≠ G446), S464 (≠ C447), N489 (= N472), E491 (≠ L474), Q492 (≠ Y475), G493 (= G476), M494 (≠ T477), V495 (≠ I478)
6desA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide propoxycarbazone (see paper)
27% identity, 95% coverage: 4:541/566 of query aligns to 14:557/598 of 6desA
- active site: Y33 (≠ V23), G35 (= G25), G36 (≠ E26), A37 (≠ S27), I38 (≠ F28), E59 (= E50), T82 (= T73), F121 (= F112), Q122 (≠ M113), E123 (≠ S114), K171 (≠ E162), K229 (≠ E219), M265 (≠ I255), V292 (≠ N282), V408 (= V393), L433 (vs. gap), G434 (= G418), M436 (= M420), D461 (= D445), N488 (= N472), E490 (≠ L474), Q491 (≠ Y475), M493 (≠ T477), V494 (≠ I478), W497 (≠ H481), L519 (= L503), N524 (≠ G508), V525 (≠ A509)
- binding methyl 2-[(4-methyl-5-oxidanylidene-3-propoxy-1,2,4-triazol-1-yl)carbonylsulfamoyl]benzoate: M265 (≠ I255), D290 (= D280), R291 (≠ V281), W497 (≠ H481)
- binding flavin-adenine dinucleotide: R161 (= R152), G218 (= G209), A219 (vs. gap), G220 (= G210), N223 (≠ W213), T245 (= T235), L246 (≠ F236), Q247 (≠ R237), L263 (≠ I253), G285 (≠ N275), A286 (≠ D276), R287 (≠ A277), D289 (≠ S279), R291 (≠ V281), V292 (≠ N282), E318 (≠ M308), I319 (≠ P309), N323 (≠ D313), D337 (= D327), V338 (≠ N328), Q412 (≠ A397), M413 (≠ T398), G431 (≠ I416)
- binding magnesium ion: D461 (= D445), N488 (= N472), E490 (≠ L474)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V408 (= V393), G409 (= G394), Q410 (≠ A395), H411 (≠ Y396), G434 (= G418), M436 (= M420), G460 (= G444), D461 (= D445), A462 (≠ G446), S463 (≠ C447), N488 (= N472), E490 (≠ L474), Q491 (≠ Y475), G492 (= G476), M493 (≠ T477), V494 (≠ I478)
6depA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide sulfometuron methyl (see paper)
27% identity, 95% coverage: 4:541/566 of query aligns to 14:557/598 of 6depA
- active site: Y33 (≠ V23), G35 (= G25), G36 (≠ E26), A37 (≠ S27), I38 (≠ F28), E59 (= E50), T82 (= T73), F121 (= F112), Q122 (≠ M113), E123 (≠ S114), K171 (≠ E162), K229 (≠ E219), M265 (≠ I255), V292 (≠ N282), V408 (= V393), L433 (vs. gap), G434 (= G418), M436 (= M420), D461 (= D445), N488 (= N472), E490 (≠ L474), Q491 (≠ Y475), M493 (≠ T477), V494 (≠ I478), W497 (≠ H481), L519 (= L503), N524 (≠ G508), V525 (≠ A509)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D290 (= D280), R291 (≠ V281), M493 (≠ T477), W497 (≠ H481)
- binding flavin-adenine dinucleotide: R161 (= R152), G218 (= G209), A219 (vs. gap), G220 (= G210), N223 (≠ W213), T245 (= T235), L246 (≠ F236), Q247 (≠ R237), L263 (≠ I253), G264 (= G254), G285 (≠ N275), A286 (≠ D276), R287 (≠ A277), D289 (≠ S279), R291 (≠ V281), V292 (≠ N282), E318 (≠ M308), I319 (≠ P309), N323 (≠ D313), D337 (= D327), V338 (≠ N328), M413 (≠ T398), G431 (≠ I416)
- binding magnesium ion: D461 (= D445), N488 (= N472), E490 (≠ L474)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V408 (= V393), G409 (= G394), Q410 (≠ A395), H411 (≠ Y396), G434 (= G418), M436 (= M420), G460 (= G444), D461 (= D445), A462 (≠ G446), S463 (≠ C447), M466 (= M450), N488 (= N472), E490 (≠ L474), Q491 (≠ Y475), G492 (= G476), M493 (≠ T477), V494 (≠ I478)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V408 (= V393), G409 (= G394), Q410 (≠ A395), H411 (≠ Y396), G434 (= G418), M436 (= M420), G460 (= G444), D461 (= D445), A462 (≠ G446), S463 (≠ C447), M466 (= M450), N488 (= N472), E490 (≠ L474), Q491 (≠ Y475), G492 (= G476), M493 (≠ T477), V494 (≠ I478)
6demA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide bensulfuron methyl (see paper)
27% identity, 95% coverage: 4:541/566 of query aligns to 14:556/597 of 6demA
- active site: Y33 (≠ V23), G35 (= G25), G36 (≠ E26), A37 (≠ S27), I38 (≠ F28), E59 (= E50), T82 (= T73), F121 (= F112), Q122 (≠ M113), E123 (≠ S114), K171 (≠ E162), K228 (≠ E219), M264 (≠ I255), V291 (≠ N282), V407 (= V393), L432 (vs. gap), G433 (= G418), M435 (= M420), D460 (= D445), N487 (= N472), E489 (≠ L474), Q490 (≠ Y475), M492 (≠ T477), V493 (≠ I478), W496 (≠ H481), L518 (= L503), N523 (≠ G508), V524 (≠ A509)
- binding methyl 2-[(4,6-dimethoxypyrimidin-2-yl)carbamoylsulfamoylmethyl]benzoate: M264 (≠ I255), D289 (= D280), R290 (≠ V281), M492 (≠ T477), W496 (≠ H481)
- binding flavin-adenine dinucleotide: R161 (= R152), G217 (= G209), A218 (vs. gap), G219 (= G210), N222 (≠ W213), T244 (= T235), L245 (≠ F236), Q246 (≠ R237), L262 (≠ I253), G284 (≠ N275), A285 (≠ D276), R286 (≠ A277), D288 (≠ S279), R290 (≠ V281), V291 (≠ N282), E317 (≠ M308), I318 (≠ P309), N322 (≠ D313), D336 (= D327), V337 (≠ N328), M412 (≠ T398), G430 (≠ I416)
- binding magnesium ion: D460 (= D445), N487 (= N472), E489 (≠ L474)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V407 (= V393), G408 (= G394), Q409 (≠ A395), H410 (≠ Y396), M435 (= M420), G459 (= G444), D460 (= D445), A461 (≠ G446), S462 (≠ C447), M465 (= M450), N487 (= N472), E489 (≠ L474), Q490 (≠ Y475), G491 (= G476), M492 (≠ T477), V493 (≠ I478)
Sites not aligning to the query:
6delA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide chlorimuron ethyl (see paper)
27% identity, 95% coverage: 4:541/566 of query aligns to 14:556/597 of 6delA
- active site: Y33 (≠ V23), G35 (= G25), G36 (≠ E26), A37 (≠ S27), I38 (≠ F28), E59 (= E50), T82 (= T73), F121 (= F112), Q122 (≠ M113), E123 (≠ S114), K171 (≠ E162), K228 (≠ E219), M264 (≠ I255), V291 (≠ N282), V407 (= V393), L432 (vs. gap), G433 (= G418), M435 (= M420), D460 (= D445), N487 (= N472), E489 (≠ L474), Q490 (≠ Y475), M492 (≠ T477), V493 (≠ I478), W496 (≠ H481), L518 (= L503), N523 (≠ G508), V524 (≠ A509)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: D289 (= D280), R290 (≠ V281), W496 (≠ H481)
- binding flavin-adenine dinucleotide: R161 (= R152), G217 (= G209), A218 (vs. gap), G219 (= G210), N222 (≠ W213), T244 (= T235), L245 (≠ F236), Q246 (≠ R237), L262 (≠ I253), G284 (≠ N275), A285 (≠ D276), R286 (≠ A277), D288 (≠ S279), R290 (≠ V281), V291 (≠ N282), E317 (≠ M308), I318 (≠ P309), N322 (≠ D313), D336 (= D327), V337 (≠ N328), M412 (≠ T398), G430 (≠ I416)
- binding (3Z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl](formyl)amino}-3-sulfanylpent-3-en-1-yl trihydrogen diphosphate: V407 (= V393), G408 (= G394), Q409 (≠ A395), H410 (≠ Y396), G433 (= G418), M435 (= M420), G459 (= G444), D460 (= D445), A461 (≠ G446), S462 (≠ C447), M465 (= M450), N487 (= N472), E489 (≠ L474), Q490 (≠ Y475), G491 (= G476), M492 (≠ T477), V493 (≠ I478)
- binding magnesium ion: D460 (= D445), N487 (= N472), E489 (≠ L474)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V407 (= V393), G408 (= G394), Q409 (≠ A395), H410 (≠ Y396), G433 (= G418), M435 (= M420), G459 (= G444), D460 (= D445), A461 (≠ G446), S462 (≠ C447), M465 (= M450), N487 (= N472), E489 (≠ L474), Q490 (≠ Y475), G491 (= G476), M492 (≠ T477), V493 (≠ I478)
6deqA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide penoxsulam (see paper)
27% identity, 95% coverage: 4:541/566 of query aligns to 16:560/601 of 6deqA
- active site: Y35 (≠ V23), G37 (= G25), G38 (≠ E26), A39 (≠ S27), I40 (≠ F28), E61 (= E50), T84 (= T73), F123 (= F112), Q124 (≠ M113), E125 (≠ S114), K173 (≠ E162), K232 (≠ E219), M268 (≠ I255), V295 (≠ N282), V411 (= V393), L436 (vs. gap), G437 (= G418), M439 (= M420), D464 (= D445), N491 (= N472), E493 (≠ L474), Q494 (≠ Y475), M496 (≠ T477), V497 (≠ I478), W500 (≠ H481), L522 (= L503), N527 (≠ G508), V528 (≠ A509)
- binding flavin-adenine dinucleotide: R163 (= R152), G221 (= G209), A222 (vs. gap), G223 (= G210), N226 (≠ W213), T248 (= T235), L249 (≠ F236), Q250 (≠ R237), L266 (≠ I253), G288 (≠ N275), A289 (≠ D276), R290 (≠ A277), D292 (≠ S279), R294 (≠ V281), V295 (≠ N282), E321 (≠ M308), I322 (≠ P309), D340 (= D327), V341 (≠ N328), M416 (≠ T398), G434 (≠ I416)
- binding magnesium ion: D464 (= D445), N491 (= N472), E493 (≠ L474)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M268 (≠ I255), R294 (≠ V281), M496 (≠ T477), V497 (≠ I478), W500 (≠ H481)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V411 (= V393), G412 (= G394), Q413 (≠ A395), H414 (≠ Y396), M439 (= M420), G463 (= G444), D464 (= D445), A465 (≠ G446), S466 (≠ C447), N491 (= N472), E493 (≠ L474), Q494 (≠ Y475), G495 (= G476), M496 (≠ T477), V497 (≠ I478)
Sites not aligning to the query:
6lpiB Crystal structure of ahas holo-enzyme (see paper)
30% identity, 95% coverage: 4:543/566 of query aligns to 8:522/539 of 6lpiB
- active site: I27 (≠ V23), G29 (= G25), G30 (≠ E26), S31 (= S27), I32 (≠ F28), E53 (= E50), C76 (≠ T73), F115 (= F112), Q116 (≠ M113), E117 (≠ S114), K165 (≠ E162), M256 (≠ I255), A283 (≠ G285), V375 (= V393), G401 (= G418), M403 (= M420), D428 (= D445), N455 (= N472), A457 (≠ L474), L458 (≠ Y475), L460 (≠ T477), V461 (≠ I480), Q464 (≠ E483)
- binding flavin-adenine dinucleotide: R155 (= R152), G212 (= G209), G213 (= G210), G214 (≠ S211), T236 (= T235), L237 (≠ F236), M238 (≠ R237), L254 (≠ I253), M256 (≠ I255), H257 (≠ G256), G276 (≠ N275), A277 (≠ D276), R278 (≠ A277), D280 (≠ S279), R282 (≠ V281), A283 (≠ G285), D300 (≠ M308), I301 (≠ P309), D319 (= D327), V320 (vs. gap), M380 (≠ T398), G398 (≠ I416)
- binding magnesium ion: D428 (= D445), N455 (= N472)
- binding thiamine diphosphate: E53 (= E50), C76 (≠ T73), P79 (= P76), G376 (= G394), Q377 (≠ A395), H378 (≠ Y396), G401 (= G418), M403 (= M420), G427 (= G444), D428 (= D445), G429 (= G446), S430 (≠ C447), M433 (= M450), N455 (= N472), A457 (≠ L474), L458 (≠ Y475), G459 (= G476), L460 (≠ T477), V461 (≠ I480)
5wkcA Saccharomyces cerevisiae acetohydroxyacid synthase in complex with the herbicide penoxsulam (see paper)
27% identity, 95% coverage: 4:541/566 of query aligns to 10:550/591 of 5wkcA
- active site: Y29 (≠ V23), G31 (= G25), G32 (≠ E26), A33 (≠ S27), I34 (≠ F28), E55 (= E50), T78 (= T73), F117 (= F112), Q118 (≠ M113), E119 (≠ S114), K167 (≠ E162), R222 (= R223), M258 (≠ I255), V285 (≠ N282), V401 (= V393), L426 (vs. gap), G427 (= G418), M429 (= M420), D454 (= D445), N481 (= N472), E483 (≠ L474), Q484 (≠ Y475), M486 (≠ T477), V487 (≠ I478), W490 (≠ H481), L512 (= L503), G517 (= G508), L518 (≠ A509)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V401 (= V393), G402 (= G394), Q403 (≠ A395), H404 (≠ Y396), G427 (= G418), M429 (= M420), G453 (= G444), D454 (= D445), A455 (≠ G446), S456 (≠ C447), M459 (= M450), N481 (= N472), E483 (≠ L474), Q484 (≠ Y475), G485 (= G476), M486 (≠ T477), V487 (≠ I478)
- binding ethaneperoxoic acid: G32 (≠ E26), Q118 (≠ M113)
- binding flavin-adenine dinucleotide: R157 (= R152), G211 (= G209), A212 (≠ G210), G213 (≠ S211), N216 (≠ S214), T238 (= T235), L239 (≠ F236), Q240 (≠ R237), L256 (≠ I253), M258 (≠ I255), G278 (≠ N275), A279 (≠ D276), R280 (≠ A277), R284 (≠ V281), V285 (≠ N282), E311 (≠ M308), V312 (≠ P309), N316 (≠ D313), D330 (= D327), A331 (≠ N328), M406 (≠ T398), G424 (≠ I416)
- binding magnesium ion: D454 (= D445), N481 (= N472), E483 (≠ L474)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: G32 (≠ E26), A33 (≠ S27), V107 (= V102), F117 (= F112), K167 (≠ E162), M258 (≠ I255), R284 (≠ V281), M486 (≠ T477), W490 (≠ H481)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: P30 (= P24), E55 (= E50)
Sites not aligning to the query:
1n0hA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorimuron ethyl (see paper)
26% identity, 95% coverage: 4:541/566 of query aligns to 12:558/599 of 1n0hA
- active site: Y31 (≠ V23), G33 (= G25), G34 (≠ E26), A35 (≠ S27), I36 (≠ F28), E57 (= E50), T80 (= T73), F119 (= F112), Q120 (≠ M113), E121 (≠ S114), K169 (≠ E162), R230 (≠ E219), M266 (≠ I255), V293 (≠ N282), V409 (= V393), L434 (vs. gap), G435 (= G418), M437 (= M420), D462 (= D445), N489 (= N472), E491 (≠ L474), Q492 (≠ Y475), M494 (≠ T477), V495 (≠ I478), W498 (≠ H481), L520 (= L503), G525 (= G508), L526 (≠ A509)
- binding 4-{[(4'-amino-2'-methylpyrimidin-5'-yl)methyl]amino}pent-3-enyl diphosphate: V409 (= V393), G410 (= G394), Q411 (≠ A395), H412 (≠ Y396), G435 (= G418), M437 (= M420), G461 (= G444), D462 (= D445), A463 (≠ G446), S464 (≠ C447), M467 (= M450), N489 (= N472), E491 (≠ L474), Q492 (≠ Y475), G493 (= G476), V495 (≠ I478)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: G34 (≠ E26), A35 (≠ S27), V109 (= V102), P110 (≠ K103), F119 (= F112), K169 (≠ E162), M266 (≠ I255), D291 (= D280), R292 (≠ V281), V495 (≠ I478), W498 (≠ H481)
- binding flavin-adenine dinucleotide: R159 (= R152), G219 (= G209), A220 (≠ G210), G221 (≠ S211), N224 (≠ S214), T246 (= T235), L247 (≠ F236), Q248 (≠ R237), L264 (≠ I253), G265 (= G254), M266 (≠ I255), H267 (≠ G256), G286 (≠ N275), A287 (≠ D276), R288 (≠ A277), D290 (≠ S279), R292 (≠ V281), V293 (≠ N282), E319 (≠ M308), V320 (≠ P309), N324 (≠ D313), G337 (≠ A326), D338 (= D327), A339 (≠ N328), M414 (≠ T398), G432 (≠ I416), G433 (≠ S417)
- binding magnesium ion: D462 (= D445), N489 (= N472), E491 (≠ L474)
- binding thiamine diphosphate: Y31 (≠ V23), E57 (= E50), P83 (= P76)
Sites not aligning to the query:
3ea4A Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron-ester (see paper)
29% identity, 95% coverage: 2:539/566 of query aligns to 11:554/582 of 3ea4A
- active site: Y32 (≠ V23), G34 (= G25), G35 (≠ E26), A36 (≠ S27), S37 (≠ F28), E58 (= E50), T81 (= T73), F120 (= F112), Q121 (≠ M113), E122 (≠ S114), K170 (≠ E162), M265 (≠ S257), V292 (≠ N282), V399 (= V393), G425 (= G418), M427 (= M420), D452 (= D445), N479 (= N472), H481 (≠ L474), L482 (≠ Y475), M484 (≠ T477), V485 (≠ I478), W488 (vs. gap)
- binding methyl 2-{[(4-methylpyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: D290 (= D280), R291 (≠ V281), W488 (vs. gap)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (= R152), G221 (= G209), G222 (= G210), G223 (≠ S211), T245 (= T235), L246 (≠ F236), M247 (≠ R237), L263 (≠ I255), G264 (= G256), M265 (≠ S257), H266 (≠ N258), G285 (≠ N275), R287 (≠ A277), D289 (≠ S279), R291 (≠ V281), D309 (≠ M308), I310 (≠ P309), G327 (≠ F318), D328 (≠ Q319), V329 (= V320), M404 (≠ T398), G422 (≠ I416)
- binding magnesium ion: D452 (= D445), N479 (= N472), H481 (≠ L474)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (= V393), G400 (= G394), Q401 (≠ A395), H402 (≠ Y396), M427 (= M420), G451 (= G444), D452 (= D445), G453 (= G446), S454 (≠ C447), N479 (= N472), H481 (≠ L474), L482 (≠ Y475), G483 (= G476), M484 (≠ T477), V485 (≠ I478)
Sites not aligning to the query:
3e9yA Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron (see paper)
29% identity, 95% coverage: 2:539/566 of query aligns to 11:554/582 of 3e9yA
- active site: Y32 (≠ V23), G34 (= G25), G35 (≠ E26), A36 (≠ S27), S37 (≠ F28), E58 (= E50), T81 (= T73), F120 (= F112), Q121 (≠ M113), E122 (≠ S114), K170 (≠ E162), M265 (≠ S257), V292 (≠ N282), V399 (= V393), G425 (= G418), M427 (= M420), D452 (= D445), N479 (= N472), H481 (≠ L474), L482 (≠ Y475), M484 (≠ T477), V485 (≠ I478), W488 (vs. gap)
- binding N-[(4-methylpyrimidin-2-yl)carbamoyl]-2-nitrobenzenesulfonamide: D290 (= D280), R291 (≠ V281), W488 (vs. gap)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (= R152), G221 (= G209), G222 (= G210), G223 (≠ S211), T245 (= T235), L246 (≠ F236), M247 (≠ R237), L263 (≠ I255), G285 (≠ N275), R287 (≠ A277), D289 (≠ S279), R291 (≠ V281), D309 (≠ M308), I310 (≠ P309), G327 (≠ F318), D328 (≠ Q319), V329 (= V320), M404 (≠ T398), G422 (≠ I416)
- binding magnesium ion: D452 (= D445), N479 (= N472), H481 (≠ L474)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (= V393), G400 (= G394), Q401 (≠ A395), H402 (≠ Y396), M427 (= M420), G451 (= G444), G453 (= G446), S454 (≠ C447), N479 (= N472), H481 (≠ L474), L482 (≠ Y475), G483 (= G476), M484 (≠ T477), V485 (≠ I478)
Sites not aligning to the query:
1t9bB Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
26% identity, 95% coverage: 4:541/566 of query aligns to 10:554/595 of 1t9bB
- active site: Y29 (≠ V23), G31 (= G25), G32 (≠ E26), A33 (≠ S27), I34 (≠ F28), E55 (= E50), T78 (= T73), F117 (= F112), Q118 (≠ M113), E119 (≠ S114), K167 (≠ E162), R226 (≠ E219), M262 (≠ I255), V289 (≠ N282), V405 (= V393), L430 (vs. gap), G431 (= G418), M433 (= M420), D458 (= D445), N485 (= N472), E487 (≠ L474), Q488 (≠ Y475), M490 (≠ T477), V491 (≠ I478), W494 (≠ H481), L516 (= L503), G521 (= G508), L522 (≠ A509)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: V107 (= V102), P108 (≠ K103), D287 (= D280), R288 (≠ V281), M490 (≠ T477), W494 (≠ H481)
- binding flavin-adenine dinucleotide: R157 (= R152), G215 (= G209), A216 (≠ G210), G217 (≠ S211), N220 (≠ S214), T242 (= T235), L243 (≠ F236), Q244 (≠ R237), M259 (≠ E252), L260 (≠ I253), M262 (≠ I255), H263 (≠ G256), G282 (≠ N275), A283 (≠ D276), R284 (≠ A277), D286 (≠ S279), R288 (≠ V281), V289 (≠ N282), E315 (≠ M308), V316 (≠ P309), N320 (≠ D313), G333 (≠ A326), D334 (= D327), A335 (≠ N328), Q409 (≠ A397), M410 (≠ T398), G428 (≠ I416), G429 (≠ S417)
- binding magnesium ion: D458 (= D445), N485 (= N472), E487 (≠ L474)
Sites not aligning to the query:
P09342 Acetolactate synthase 1, chloroplastic; ALS I; Acetohydroxy-acid synthase I; Acetolactate synthase I; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see 2 papers)
29% identity, 95% coverage: 2:540/566 of query aligns to 94:638/667 of P09342
- C161 (≠ A70) modified: Disulfide link with 307
- P194 (≠ K103) mutation to Q: In C3; highly resistant to sulfonylurea herbicides.
- C307 (≠ W213) modified: Disulfide link with 161
1t9dA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
26% identity, 95% coverage: 4:541/566 of query aligns to 10:555/596 of 1t9dA
- active site: Y29 (≠ V23), G31 (= G25), G32 (≠ E26), A33 (≠ S27), I34 (≠ F28), E55 (= E50), T78 (= T73), F117 (= F112), Q118 (≠ M113), E119 (≠ S114), K167 (≠ E162), R227 (≠ E219), M263 (≠ I255), V290 (≠ N282), V406 (= V393), L431 (vs. gap), G432 (= G418), M434 (= M420), D459 (= D445), N486 (= N472), E488 (≠ L474), Q489 (≠ Y475), M491 (≠ T477), V492 (≠ I478), W495 (≠ H481), L517 (= L503), G522 (= G508), L523 (≠ A509)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G32 (≠ E26), A33 (≠ S27), V107 (= V102), P108 (≠ K103), F117 (= F112), K167 (≠ E162), M263 (≠ I255), D288 (= D280), R289 (≠ V281), W495 (≠ H481)
- binding flavin-adenine dinucleotide: R157 (= R152), G216 (= G209), A217 (≠ G210), G218 (≠ S211), N221 (≠ S214), T243 (= T235), L244 (≠ F236), Q245 (≠ R237), M260 (≠ E252), L261 (≠ I253), H264 (≠ G256), G283 (≠ N275), A284 (≠ D276), R285 (≠ A277), D287 (≠ S279), R289 (≠ V281), V290 (≠ N282), E316 (≠ M308), V317 (≠ P309), N321 (≠ D313), G334 (≠ A326), D335 (= D327), A336 (≠ N328), Q410 (≠ A397), M411 (≠ T398), G429 (≠ I416), G430 (≠ S417)
- binding magnesium ion: D459 (= D445), N486 (= N472), E488 (≠ L474)
- binding 2,5-dimethyl-pyrimidin-4-ylamine: E55 (= E50), P81 (= P76), Q118 (≠ M113), G432 (= G418), M434 (= M420), M464 (= M450)
Sites not aligning to the query:
Query Sequence
>SMa2211 FitnessBrowser__Smeli:SMa2211
MRKGAEILADELAVNGAEIVYHVPGESFLTALDSLTTRHPRIRSVSCRHENGAAQMAEAY
GKLTGKPGIAFATRSPGATNAVNGVHTAFQDSSPMILIVGQVKRSILEREAFMSYDFRTM
FAPMAKWVGQIDDPARIPEFVQRAWATALSGRRGPVVLVVPEDVLEEKCDVAPSARPAVA
SHAGAPREEDLDRIFAMLAAAAKPLVVVGGSGWSETAREDVQRFATNLGLPVVTTFRRRD
IIDHRLHCYVGEIGIGSNPTLLAHIREADFILMLNDALSDVNTIGAGYMEGFTLFSIPRP
RQRVVHVMPDHGDLNRVFQVDLALAADNDATARALAGRSATPRAEHADWTSTLRATLMKE
CEPQPCPGAIDLPGVMGWLRERLPEDAIVTNGVGAYATWSQRYFPHYRLHTQLGPISGSM
GYSLPAAISAKIAHPDRVVVEFVGDGCFQMSSEELATAVQYGVNIIIVLFNNGLYGTIRI
HEETRLEGRVNGTDLTNPDFLLLAKAYGAHGERVTCTKEFAPAFERCLAAGKPALIELVV
DPEAIHCRYSLSDLRARRAARVPHEE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory