Comparing SMa2365 FitnessBrowser__Smeli:SMa2365 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
34% identity, 98% coverage: 3:499/508 of query aligns to 2:496/501 of P04983
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
31% identity, 43% coverage: 5:222/508 of query aligns to 2:217/241 of 4u00A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
28% identity, 42% coverage: 8:222/508 of query aligns to 4:217/240 of 4ymuJ
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
28% identity, 45% coverage: 5:235/508 of query aligns to 4:244/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
28% identity, 45% coverage: 5:235/508 of query aligns to 4:244/253 of 1g9xB
3d31A Modbc from methanosarcina acetivorans (see paper)
32% identity, 42% coverage: 5:218/508 of query aligns to 1:205/348 of 3d31A
Sites not aligning to the query:
7o12B Abc transporter nosdfy, amppnp-bound in gdn (see paper)
33% identity, 42% coverage: 6:217/508 of query aligns to 3:203/298 of 7o12B
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
34% identity, 38% coverage: 23:217/508 of query aligns to 25:218/226 of 5xu1B
7o17B Abc transporter nosdfy e154q, atp-bound in lipid nanodisc (see paper)
33% identity, 42% coverage: 6:217/508 of query aligns to 3:203/298 of 7o17B
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
31% identity, 44% coverage: 1:222/508 of query aligns to 1:226/233 of P75957
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
28% identity, 57% coverage: 20:308/508 of query aligns to 20:289/343 of P30750
Sites not aligning to the query:
7mdyC Lolcde nucleotide-bound
32% identity, 43% coverage: 7:222/508 of query aligns to 7:223/226 of 7mdyC
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
31% identity, 42% coverage: 7:220/508 of query aligns to 8:220/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
31% identity, 42% coverage: 7:220/508 of query aligns to 8:220/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
31% identity, 42% coverage: 7:220/508 of query aligns to 8:220/353 of 1oxuA
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
31% identity, 42% coverage: 7:220/508 of query aligns to 8:220/353 of Q97UY8
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
28% identity, 57% coverage: 20:308/508 of query aligns to 21:290/344 of 6cvlD
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
28% identity, 57% coverage: 20:308/508 of query aligns to 21:290/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
28% identity, 57% coverage: 20:308/508 of query aligns to 21:290/344 of 3tuiC
Sites not aligning to the query:
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
31% identity, 43% coverage: 3:221/508 of query aligns to 2:216/285 of 4yerA
>SMa2365 FitnessBrowser__Smeli:SMa2365
MSEAILNICSVSKRFGDNLANDDISLSLGKGEIVALLGENGAGKTTLMSILFGHYVPDSG
KVLVEGRELPPGKPRAAIRAGIGMVHQHFSLAPNLTVLENVMAGTERLWHLRSGTSAARR
KLHRICQRFGLTVEPDARVGDLSVGEQQRVEILKALYNDAHILVLDEPTAVLTNLEAERL
FSTLKDMAREGLSLIFISHKLDEVMAAANRIVVLRGGRKVAERLAKETNKAELAELMVGR
RVARPVREPSTPGEVVLKVADVSVSIDGVERLKSIDFSLRAGEVLGIIGVSGNGQTTLAH
LLSGTLRRDKGDLLLFGEPIGDLTVDDAVRAGIGRIPEDRNKEGAIGEMAIWENAVLERL
PRFSRYGLVDRPSGQAFAGQIIDAFDVRGGRPTTRTRLLSGGNMQKLILGRNLMDRPRIL
LAAQPARGLDEGAVAAVHERLLEARRAGTAVLLISEDLEEVMALADRIQAIVNGRLSPPI
AADSASATKLGLMMAGEWNEEHEVPHAF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory