Comparing SMa2402 FitnessBrowser__Smeli:SMa2402 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5o5cB The crystal structure of dfoj, the desferrioxamine biosynthetic pathway lysine decarboxylase from the fire blight disease pathogen erwinia amylovora (see paper)
42% identity, 82% coverage: 82:487/495 of query aligns to 60:463/468 of 5o5cB
Q80WP8 Acidic amino acid decarboxylase GADL1; Aspartate 1-decarboxylase; ADC; Cysteine sulfinic acid decarboxylase; CSADC; Glutamate decarboxylase-like protein 1; EC 4.1.1.11; EC 4.1.1.29 from Mus musculus (Mouse) (see paper)
31% identity, 82% coverage: 84:488/495 of query aligns to 127:550/550 of Q80WP8
6enzA Crystal structure of mouse gadl1 (see paper)
30% identity, 82% coverage: 84:488/495 of query aligns to 69:487/487 of 6enzA
Q05683 Glutamate decarboxylase 2; 65 kDa glutamic acid decarboxylase; GAD-65; Glutamate decarboxylase 65 kDa isoform; EC 4.1.1.15 from Rattus norvegicus (Rat) (see 2 papers)
31% identity, 80% coverage: 92:488/495 of query aligns to 167:585/585 of Q05683
Sites not aligning to the query:
Q05329 Glutamate decarboxylase 2; 65 kDa glutamic acid decarboxylase; GAD-65; Glutamate decarboxylase 65 kDa isoform; EC 4.1.1.15 from Homo sapiens (Human) (see 3 papers)
31% identity, 80% coverage: 92:488/495 of query aligns to 167:585/585 of Q05329
Sites not aligning to the query:
2okkA The x-ray crystal structure of the 65kda isoform of glutamic acid decarboxylase (gad65) (see paper)
31% identity, 79% coverage: 92:481/495 of query aligns to 80:477/483 of 2okkA
6zekA Crystal structure of mouse csad (see paper)
34% identity, 80% coverage: 35:428/495 of query aligns to 6:410/476 of 6zekA
2okjB The x-ray crystal structure of the 67kda isoform of glutamic acid decarboxylase (gad67) (see paper)
29% identity, 87% coverage: 61:492/495 of query aligns to 57:504/504 of 2okjB
3vp6A Structural characterization of glutamic acid decarboxylase; insights into the mechanism of autoinactivation (see paper)
29% identity, 85% coverage: 61:481/495 of query aligns to 57:495/500 of 3vp6A
Q99259 Glutamate decarboxylase 1; 67 kDa glutamic acid decarboxylase; GAD-67; Glutamate decarboxylase 67 kDa isoform; EC 4.1.1.15 from Homo sapiens (Human) (see 4 papers)
28% identity, 86% coverage: 61:488/495 of query aligns to 149:594/594 of Q99259
Sites not aligning to the query:
2jisB Human cysteine sulfinic acid decarboxylase (csad) in complex with plp.
34% identity, 70% coverage: 84:428/495 of query aligns to 64:419/487 of 2jisB
4obvC Ruminococcus gnavus tryptophan decarboxylase rumgna_01526 (alpha-fmt) (see paper)
28% identity, 84% coverage: 73:490/495 of query aligns to 50:467/471 of 4obvC
A7B1V0 Tryptophan decarboxylase; Trp decarboxylase; EC 4.1.1.105 from Ruminococcus gnavus (strain ATCC 29149 / VPI C7-9) (see paper)
28% identity, 84% coverage: 73:490/495 of query aligns to 65:485/490 of A7B1V0
4obuA Ruminococcus gnavus tryptophan decarboxylase rumgna_01526 (apo) (see paper)
27% identity, 84% coverage: 73:490/495 of query aligns to 50:457/462 of 4obuA
4rlgD The clear crystal structure of pyridoxal-dependent decarboxylase from sphaerobacter thermophilus dsm 20745
34% identity, 83% coverage: 72:481/495 of query aligns to 47:465/470 of 4rlgD
4rizC The crystal structure of y333q mutant pyridoxal-dependent decarboxylase from sphaerobacter thermophilus dsm 20745
34% identity, 83% coverage: 73:481/495 of query aligns to 57:470/476 of 4rizC
7xinA Crystal structure of dodc from pseudomonas
29% identity, 85% coverage: 74:492/495 of query aligns to 47:470/470 of 7xinA
P14173 Aromatic-L-amino-acid decarboxylase; AADC; DOPA decarboxylase; DDC; EC 4.1.1.28 from Rattus norvegicus (Rat) (see 2 papers)
27% identity, 79% coverage: 31:420/495 of query aligns to 4:412/480 of P14173
A0A2I6B3P0 4-hydroxyphenylacetaldehyde synthase; HPAA synthase; Rr4HPAAS; RrHPAAS; EC 4.1.1.108 from Rhodiola rosea (Roseroot) (Sedum rhodiola) (see paper)
25% identity, 84% coverage: 71:488/495 of query aligns to 60:488/490 of A0A2I6B3P0
8oraA Human holo aromatic l-amino acid decarboxylase (aadc) external aldimine with l-dopa methylester (see paper)
26% identity, 78% coverage: 33:420/495 of query aligns to 6:412/480 of 8oraA
>SMa2402 FitnessBrowser__Smeli:SMa2402
MNINVAAFRTPPTKQTDHADQILGTDSESRRVFRNAMLQAIDMVVDQTAAASSLYSGTSF
QGLRGLIDDLDPLPEVGTGIAAALAEIGRPALEHAMVVGHPAAMAHLHCPVAVPALAAEV
LISATNQSLDSWDQSPFATLVEERVLACLTQLAELPASASGNFTSGGTQSNMTALYLAAV
RCGPDARKAGVVLTSAHAHFSIRKSAAILGFAEDAVIAIAADADGRMSVPALKAELLRVA
GEGRIPVAVVATAGTTDLGAIDPLVEIADLAAAQNVWMHVDAAYGGGLLFSRHRSRLEGL
EHAHSITLDFHKMLFQPISCGVLLLRDRADFAPLASKADYLNPEDAVFADAPNLVERSMQ
TTRRADALKILMTMRAIGRDGLDALICQTLQNTHAAAEAVKTREYLSLAGPPSLSTVLFR
YVSARGPKFADAITLKTRAALFNAGIAALATTVLDGRVHFKLTLLNPRSTPDVVHRILDA
IGETARELETHHARP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory