Comparing SMc00161 FitnessBrowser__Smeli:SMc00161 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5khaA Structure of glutamine-dependent NAD+ synthetase from acinetobacter baumannii in complex with adenosine diphosphate (adp)
40% identity, 97% coverage: 10:554/560 of query aligns to 2:520/526 of 5khaA
2e18A Crystal structure of project ph0182 from pyrococcus horikoshii ot3
34% identity, 46% coverage: 275:531/560 of query aligns to 5:243/256 of 2e18A
Sites not aligning to the query:
O25096 NH(3)-dependent NAD(+) synthetase; EC 6.3.1.5 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
32% identity, 44% coverage: 273:519/560 of query aligns to 2:237/260 of O25096
1xngB Crystal structure of nh3-dependent NAD+ synthetase from helicobacter pylori (see paper)
33% identity, 44% coverage: 275:519/560 of query aligns to 2:235/262 of 1xngB
Sites not aligning to the query:
3fiuA Structure of nmn synthetase from francisella tularensis (see paper)
32% identity, 36% coverage: 296:494/560 of query aligns to 28:207/238 of 3fiuA
3dlaA X-ray crystal structure of glutamine-dependent NAD+ synthetase from mycobacterium tuberculosis bound to naad+ and don (see paper)
27% identity, 40% coverage: 11:236/560 of query aligns to 13:259/651 of 3dlaA
Sites not aligning to the query:
3sytA Crystal structure of glutamine-dependent NAD+ synthetase from m. Tuberculosis bound to amp/ppi, NAD+, and glutamate (see paper)
27% identity, 40% coverage: 11:236/560 of query aligns to 12:258/660 of 3sytA
Sites not aligning to the query:
3dlaB X-ray crystal structure of glutamine-dependent NAD+ synthetase from mycobacterium tuberculosis bound to naad+ and don (see paper)
27% identity, 40% coverage: 11:236/560 of query aligns to 12:258/649 of 3dlaB
Sites not aligning to the query:
3sytD Crystal structure of glutamine-dependent NAD+ synthetase from m. Tuberculosis bound to amp/ppi, NAD+, and glutamate (see paper)
27% identity, 40% coverage: 11:236/560 of query aligns to 12:258/649 of 3sytD
Sites not aligning to the query:
P9WJJ3 Glutamine-dependent NAD(+) synthetase; NAD(+) synthase [glutamine-hydrolyzing]; EC 6.3.5.1 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
27% identity, 40% coverage: 11:236/560 of query aligns to 12:258/679 of P9WJJ3
Sites not aligning to the query:
3seqD Crystal structure of c176a mutant of glutamine-dependent NAD+ synthetase from m. Tuberculosis in complex with ampcpp and naad+ (see paper)
27% identity, 40% coverage: 11:236/560 of query aligns to 13:259/650 of 3seqD
Sites not aligning to the query:
3sezA Crystal structure of c176a mutant of glutamine-dependent NAD+ synthetase from m. Tuberculosis in complex with atp and naad+ (see paper)
27% identity, 40% coverage: 11:236/560 of query aligns to 12:258/658 of 3sezA
Sites not aligning to the query:
3sezC Crystal structure of c176a mutant of glutamine-dependent NAD+ synthetase from m. Tuberculosis in complex with atp and naad+ (see paper)
27% identity, 40% coverage: 11:236/560 of query aligns to 12:258/648 of 3sezC
Sites not aligning to the query:
6ofcC Crystal structure of m. Tuberculosis glutamine-dependent NAD+ synthetase complexed with sulfonamide derivative 1, pyrophosphate, and glutamine (see paper)
27% identity, 40% coverage: 11:236/560 of query aligns to 12:258/665 of 6ofcC
Sites not aligning to the query:
3seqA Crystal structure of c176a mutant of glutamine-dependent NAD+ synthetase from m. Tuberculosis in complex with ampcpp and naad+ (see paper)
27% identity, 40% coverage: 11:236/560 of query aligns to 13:259/661 of 3seqA
Sites not aligning to the query:
6ofcB Crystal structure of m. Tuberculosis glutamine-dependent NAD+ synthetase complexed with sulfonamide derivative 1, pyrophosphate, and glutamine (see paper)
27% identity, 40% coverage: 11:236/560 of query aligns to 12:258/669 of 6ofcB
Sites not aligning to the query:
Q9VYA0 Glutamine-dependent NAD(+) synthetase; NAD(+) synthase [glutamine-hydrolyzing]; EC 6.3.5.1 from Drosophila melanogaster (Fruit fly) (see paper)
22% identity, 83% coverage: 13:479/560 of query aligns to 7:581/787 of Q9VYA0
Sites not aligning to the query:
5f23A Crystal structure of nh(3)-dependent NAD(+) synthetase pseudomonas aeruginosa in complex with NAD
28% identity, 37% coverage: 261:467/560 of query aligns to 14:220/263 of 5f23A
Sites not aligning to the query:
2pz8A NAD+ synthetase from bacillus anthracis with amp-cpp and mg2+ (see paper)
28% identity, 40% coverage: 273:494/560 of query aligns to 20:237/280 of 2pz8A
2nsyA Crystal structure of nh3-dependent NAD+ synthetase from bacillus subtilis in complex with NAD-adenylate (see paper)
29% identity, 41% coverage: 264:494/560 of query aligns to 12:236/271 of 2nsyA
Sites not aligning to the query:
>SMc00161 FitnessBrowser__Smeli:SMc00161
MTAQKAAPSTLRIAVAQLNPTVGDIAGNVAKAREARTAAAREGADLLLLTELFISGYPPE
DLVLKPAFLKACEQAVEKLAAETADGGPGVVIGFPRQAAGLRHNSVAVLDGGRVIAIRDK
VDLPNYGEFDEKRVFDAGEMPGPVNFRGVRIGIPVCEDIWGDLGVCETLAESGAEILLSP
NGSPYYRGKVDVRHQVVLRQVIETGLPMIYANQLGGQDELVFDGASFAFNADKSLAFQMS
QFEEAVAVSEWKRGAGGWISANGLKSRIPEGEEADYRACMLGFRDYVNKNGFRNVVLGLS
GGIDSAICTALAVDALGEERVRTVMLPYRYTSRESLRDAEACAKALGCRYDIVAIEEPVE
GFLSALADTFEGTEAGITEENLQSRTRGTILMAISNKFGSMVVTTGNKSEMSVGYATLYG
DMNGGFNPIKDLYKMQVYALARWRNGTVPPGALGPSGEVIPQNIIDKAPSAELRPDQTDQ
DSLPPYPVLDDILECLVEKEMSTEEIVARGHEEATVHRIEHLLYIAEYKRRQSAPGVKIT
RKNFGRDRRYPITNRFRDRG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory