SitesBLAST
Comparing SMc00260 FitnessBrowser__Smeli:SMc00260 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
39% identity, 93% coverage: 9:244/254 of query aligns to 10:249/252 of 1vl8B
- active site: G17 (= G16), S143 (= S140), I154 (≠ R150), Y157 (= Y153), K161 (= K157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G12), R16 (≠ S15), G17 (= G16), L18 (≠ I17), S37 (≠ D36), R38 (= R37), C63 (= C59), D64 (≠ S60), V65 (= V61), A91 (≠ S87), A92 (= A88), G93 (= G89), I94 (= I90), V114 (= V110), I141 (= I138), S143 (= S140), Y157 (= Y153), K161 (= K157), P187 (= P183), G188 (= G184), Y190 (≠ I186), T192 (= T188), M194 (≠ L190), T195 (≠ S191)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
37% identity, 94% coverage: 6:245/254 of query aligns to 8:243/244 of 4nbuB
- active site: G18 (= G16), N111 (= N111), S139 (= S140), Q149 (≠ R150), Y152 (= Y153), K156 (= K157)
- binding acetoacetyl-coenzyme a: D93 (= D93), K98 (≠ E98), S139 (= S140), N146 (= N147), V147 (≠ K148), Q149 (≠ R150), Y152 (= Y153), F184 (≠ A185), M189 (≠ L190), K200 (≠ Q202)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G12), N17 (≠ S15), G18 (= G16), I19 (= I17), D38 (= D36), F39 (≠ R37), V59 (≠ C59), D60 (≠ S60), V61 (= V61), N87 (≠ S87), A88 (= A88), G89 (= G89), I90 (= I90), T137 (≠ I138), S139 (= S140), Y152 (= Y153), K156 (= K157), P182 (= P183), F184 (≠ A185), T185 (≠ I186), T187 (= T188), M189 (≠ L190)
3ay6B Crystal structure of bacillus megaterium glucose dehydrogenase 4 a258f mutant in complex with nadh and d-glucose (see paper)
37% identity, 94% coverage: 6:244/254 of query aligns to 14:256/267 of 3ay6B
- active site: G24 (= G16), S151 (= S140), Y164 (= Y153), K168 (= K157)
- binding beta-D-glucopyranose: E102 (≠ A91), S151 (= S140), H153 (≠ S142), W158 (≠ N147), Y164 (= Y153), N202 (≠ S191), K205 (≠ V194)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G20 (= G12), T23 (≠ S15), G24 (= G16), L25 (≠ I17), Y45 (≠ D36), D71 (vs. gap), V72 (= V61), N98 (≠ S87), A99 (= A88), G100 (= G89), V101 (≠ I90), M149 (≠ I138), S151 (= S140), Y164 (= Y153), K168 (= K157), P194 (= P183), G195 (= G184), M197 (≠ I186), T199 (= T188), P200 (= P189), I201 (≠ L190), N202 (≠ S191)
4iinA Crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from helicobacter pylori 26695 complexed with NAD+
35% identity, 94% coverage: 6:244/254 of query aligns to 7:234/236 of 4iinA
- active site: G17 (= G16), S143 (= S140), Y156 (= Y153), K160 (= K157)
- binding nicotinamide-adenine-dinucleotide: G13 (= G12), G17 (= G16), I18 (= I17), N36 (≠ M35), R38 (= R37), A65 (≠ V61), N91 (≠ S87), A92 (= A88), G93 (= G89), V141 (≠ I138), S143 (= S140), Y156 (= Y153), K160 (= K157), P186 (= P183)
8jfgA Crystal structure of 3-oxoacyl-acp reductase fabg in complex with NADP+ and 3-keto-octanoyl-acp from helicobacter pylori (see paper)
36% identity, 94% coverage: 6:244/254 of query aligns to 7:246/248 of 8jfgA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G12), K16 (≠ S15), I18 (= I17), R38 (= R37), A65 (≠ V61), N91 (≠ S87), A92 (= A88), G93 (= G89), A142 (≠ S139), S143 (= S140), Y156 (= Y153), K160 (= K157), P186 (= P183), I189 (= I186), T191 (= T188), M193 (≠ L190), N194 (≠ S191)
- binding ~{S}-[2-[3-[[(2~{S})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] 3-oxidanylideneoctanethioate: D97 (= D93), S143 (= S140), I145 (≠ S142), M151 (≠ K148), G152 (= G149), Q153 (≠ R150), Y156 (= Y153), G187 (= G184), F188 (≠ A185), Y205 (≠ W203)
2cfcA Structural basis for stereo selectivity in the (r)- and (s)-hydroxypropylethane thiosulfonate dehydrogenases (see paper)
37% identity, 93% coverage: 9:244/254 of query aligns to 6:247/250 of 2cfcA
- active site: G13 (= G16), S142 (= S140), Y155 (= Y153), K159 (= K157)
- binding (2-[2-ketopropylthio]ethanesulfonate: F149 (≠ N147), R152 (= R150), Y155 (= Y153), W195 (vs. gap), R196 (≠ A193)
- binding nicotinamide-adenine-dinucleotide: G9 (= G12), S12 (= S15), G13 (= G16), N14 (≠ I17), D33 (= D36), L34 (≠ R37), A59 (≠ C59), D60 (≠ S60), V61 (= V61), N87 (≠ S87), A88 (= A88), G89 (= G89), I140 (= I138), P185 (= P183), G186 (= G184), M187 (≠ A185), I188 (= I186), T190 (= T188), P191 (= P189), M192 (≠ L190), T193 (≠ S191)
Q56840 2-(R)-hydroxypropyl-CoM dehydrogenase; R-HPCDH; 2-[(R)-2-hydroxypropylthio]ethanesulfonate dehydrogenase; Aliphatic epoxide carboxylation component III; Epoxide carboxylase component III; RHPCDH1; EC 1.1.1.268 from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) (see 4 papers)
37% identity, 93% coverage: 9:244/254 of query aligns to 6:247/250 of Q56840
- SGN 12:14 (≠ SGI 15:17) binding
- D33 (= D36) binding
- DV 60:61 (≠ SV 60:61) binding
- N87 (≠ S87) binding
- S142 (= S140) mutation to A: Retains weak activity. 120-fold decrease in kcat.; mutation to C: Loss of activity.
- R152 (= R150) binding ; mutation to A: Almost loss of activity with the natural substrate 2-KPC, but does not affect activity with 2-butanone as substrate.
- Y155 (= Y153) mutation Y->E,F: Loss of activity.
- K159 (= K157) mutation to A: Loss of activity.
- R179 (= R177) mutation to A: Loss of activity.
- IETPM 188:192 (≠ IDTPL 186:190) binding
- WR 195:196 (≠ -A 193) binding
- R196 (≠ A193) mutation to A: Almost loss of activity with the natural substrate 2-KPC, but does not affect activity with 2-butanone as substrate.
- R203 (= R200) mutation to A: Slight decrease in catalytic efficiency.
- R209 (= R206) mutation to A: Does not affect catalytic efficiency.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
3lqfA Crystal structure of the short-chain dehydrogenase galactitol- dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD and erythritol (see paper)
42% identity, 93% coverage: 10:244/254 of query aligns to 16:251/254 of 3lqfA
- active site: G22 (= G16), S144 (= S140), Y159 (= Y153), K163 (= K157)
- binding meso-erythritol: N151 (= N147), Y159 (= Y153), Y191 (≠ A185), T197 (≠ S191), M200 (≠ A193)
- binding nicotinamide-adenine-dinucleotide: G18 (= G12), S21 (= S15), G22 (= G16), I23 (= I17), D42 (= D36), R43 (= R37), D66 (≠ S60), V67 (= V61), S92 (= S87), L142 (≠ I138), S144 (= S140), K163 (= K157), P189 (= P183), V192 (≠ I186), T194 (= T188), M196 (≠ L190), T197 (≠ S191)
2wsbA Crystal structure of the short-chain dehydrogenase galactitol-dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD (see paper)
42% identity, 93% coverage: 10:244/254 of query aligns to 16:251/254 of 2wsbA
- active site: G22 (= G16), S144 (= S140), Y159 (= Y153), K163 (= K157)
- binding nicotinamide-adenine-dinucleotide: G18 (= G12), S21 (= S15), G22 (= G16), I23 (= I17), D42 (= D36), R43 (= R37), D66 (≠ S60), V67 (= V61), S92 (= S87), A93 (= A88), L142 (≠ I138), S144 (= S140), Y159 (= Y153), K163 (= K157), P189 (= P183), V192 (≠ I186), T194 (= T188), M196 (≠ L190), T197 (≠ S191)
- binding n-propanol: S144 (= S140), M145 (≠ V141), N151 (= N147), N151 (= N147), Y159 (= Y153), Y159 (= Y153), Y191 (≠ A185)
2wdzA Crystal structure of the short chain dehydrogenase galactitol-dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD+ and 1,2-pentandiol (see paper)
42% identity, 93% coverage: 10:244/254 of query aligns to 16:251/254 of 2wdzA
- active site: G22 (= G16), S144 (= S140), Y159 (= Y153), K163 (= K157)
- binding (2S)-pentane-1,2-diol: A45 (= A39), D49 (≠ A43), R62 (≠ A56), S146 (= S142), Y159 (= Y153)
- binding nicotinamide-adenine-dinucleotide: G18 (= G12), S21 (= S15), G22 (= G16), I23 (= I17), D42 (= D36), R43 (= R37), A65 (≠ C59), D66 (≠ S60), V67 (= V61), S92 (= S87), A93 (= A88), L142 (≠ I138), S144 (= S140), Y159 (= Y153), K163 (= K157), P189 (= P183), V192 (≠ I186), T194 (= T188), M196 (≠ L190), T197 (≠ S191)
C0KTJ6 Galactitol 2-dehydrogenase (L-tagatose-forming); Galactitol dehydrogenase; GDH; GatDH; Galactitol:NAD(+) 5-oxidoreductase; EC 1.1.1.406 from Cereibacter sphaeroides (Rhodobacter sphaeroides) (see paper)
42% identity, 93% coverage: 10:244/254 of query aligns to 16:251/254 of C0KTJ6
Sites not aligning to the query:
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
37% identity, 94% coverage: 6:244/254 of query aligns to 5:244/246 of 3osuA
6vspB Structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a (see paper)
37% identity, 94% coverage: 6:243/254 of query aligns to 8:242/252 of 6vspB
H9XP47 Meso-2,3-butanediol dehydrogenase; BDH; meso-2,3-BDH; (R,S)-butane-2,3-diol dehydrogenase; NAD(H)-dependent meso-2,3-BDH; SmBdh; EC 1.1.1.- from Serratia marcescens (see paper)
37% identity, 94% coverage: 6:243/254 of query aligns to 6:240/251 of H9XP47
- N15 (≠ S15) binding
- M17 (≠ I17) binding
- D36 (= D36) binding
- D60 (≠ S60) binding
- V61 (= V61) binding
- N87 (≠ S87) binding
- S138 (= S140) binding ; binding
- V139 (= V141) mutation to Q: Retains 50% of activity with acetoin as substrate; when associated with A-247.
- S140 (= S142) binding
- Y151 (= Y153) binding ; binding ; binding
- K155 (= K157) binding
- V184 (≠ I186) binding
- T186 (= T188) binding
- RDK 197:199 (≠ RAQ 200:202) mutation to SEAAGKPLGYGTET: Mimics longer alpha6 helix. Retains 3% of activity with acetoin as substrate.
Sites not aligning to the query:
- 247 Q→A: Retains 10% of activity with acetoin as substrate. Retains 50% of activity with acetoin as substrate; when associated with Q-139.
6vspA Structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a (see paper)
37% identity, 94% coverage: 6:243/254 of query aligns to 6:240/251 of 6vspA
- active site: G16 (= G16), S138 (= S140), Y151 (= Y153)
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), N15 (≠ S15), G16 (= G16), M17 (≠ I17), D36 (= D36), W37 (≠ R37), W37 (≠ R37), A38 (≠ N38), I59 (≠ C59), D60 (≠ S60), V61 (= V61), N87 (≠ S87), A88 (= A88), G89 (= G89), V90 (≠ I90), V110 (= V110), T136 (≠ I138), S138 (= S140), Y151 (= Y153), K155 (= K157), P181 (= P183), S182 (≠ G184), L183 (≠ A185), V184 (≠ I186), T186 (= T188), N187 (≠ P189), M188 (≠ L190), T189 (≠ S191)
6xewA Structure of serratia marcescens 2,3-butanediol dehydrogenase (see paper)
37% identity, 94% coverage: 6:243/254 of query aligns to 6:240/251 of 6xewA
- active site: G16 (= G16), S138 (= S140), Y151 (= Y153)
- binding r,3-hydroxybutan-2-one: S138 (= S140), S140 (= S142), Y151 (= Y153)
- binding s,3-hydroxybutan-2-one: S138 (= S140), Y151 (= Y153), S182 (≠ G184)
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), N15 (≠ S15), G16 (= G16), M17 (≠ I17), D36 (= D36), W37 (≠ R37), W37 (≠ R37), A38 (≠ N38), I59 (≠ C59), D60 (≠ S60), V61 (= V61), N87 (≠ S87), A88 (= A88), G89 (= G89), V110 (= V110), T136 (≠ I138), S138 (= S140), Y151 (= Y153), K155 (= K157), S182 (≠ G184), L183 (≠ A185), V184 (≠ I186), T186 (= T188), N187 (≠ P189), M188 (≠ L190), T189 (≠ S191)
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
37% identity, 94% coverage: 6:244/254 of query aligns to 2:237/239 of 3sj7A
- active site: G12 (= G16), S138 (= S140), Q148 (≠ R150), Y151 (= Y153), K155 (= K157)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G12), S10 (≠ A14), R11 (≠ S15), I13 (= I17), N31 (vs. gap), Y32 (vs. gap), A33 (vs. gap), G34 (vs. gap), S35 (≠ M35), A58 (≠ C59), N59 (≠ S60), V60 (= V61), N86 (≠ S87), A87 (= A88), T109 (≠ V110), S138 (= S140), Y151 (= Y153), K155 (= K157), P181 (= P183), G182 (= G184)
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
37% identity, 94% coverage: 6:245/254 of query aligns to 9:246/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G12), R18 (≠ S15), G19 (= G16), I20 (= I17), D39 (= D36), R40 (= R37), C63 (= C59), I65 (≠ V61), N91 (≠ S87), G93 (= G89), I94 (= I90), V114 (= V110), Y155 (= Y153), K159 (= K157), I188 (= I186), T190 (= T188), T193 (≠ S191)
6zzsD Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and 3-oxovalerate (see paper)
35% identity, 94% coverage: 6:244/254 of query aligns to 8:258/261 of 6zzsD
- active site: G18 (= G16), S143 (= S140), Y156 (= Y153)
- binding nicotinamide-adenine-dinucleotide: G14 (= G12), S17 (= S15), I19 (= I17), D38 (= D36), M39 (≠ R37), D64 (≠ S60), V65 (= V61), N91 (≠ S87), A92 (= A88), G93 (= G89), M141 (≠ I138), A142 (≠ S139), S143 (= S140), Y156 (= Y153), K160 (= K157), P186 (= P183), G187 (= G184), V189 (≠ I186), T191 (= T188), L193 (= L190)
- binding 3-oxidanylidenepentanoic acid: Q95 (≠ A91), S143 (= S140), N145 (≠ S142), K153 (≠ R150), Y156 (= Y153), Q197 (≠ V194)
6zzqA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and acetoacetate (see paper)
35% identity, 94% coverage: 6:244/254 of query aligns to 7:257/260 of 6zzqA
- active site: G17 (= G16), S142 (= S140), Y155 (= Y153)
- binding acetoacetic acid: Q94 (≠ A91), S142 (= S140), K152 (≠ R150), Y155 (= Y153), Q196 (≠ V194)
- binding nicotinamide-adenine-dinucleotide: G13 (= G12), S16 (= S15), G17 (= G16), I18 (= I17), D37 (= D36), M38 (≠ R37), D63 (≠ S60), V64 (= V61), N90 (≠ S87), A91 (= A88), G92 (= G89), M140 (≠ I138), A141 (≠ S139), S142 (= S140), Y155 (= Y153), K159 (= K157), Y187 (≠ A185), V188 (≠ I186), T190 (= T188)
Query Sequence
>SMc00260 FitnessBrowser__Smeli:SMc00260
MSDGMKSVLITGGASGIGLEIARLLHERGWRVYLMDRNADALADACRAIPIDPAQAIACS
VTDEKEVESAIATAAAAGAPLRAVINSAGIAMDRPAVETSVDDFRRILDVNLTGTFIVCR
EAARHWLATATPGAIVNISSVSGLVGNKGRAAYGASKGAVNLLTYILATELGQDGIRVNA
IAPGAIDTPLSRAVHTDDVRAQWHERIPQRRYGSSREIAASAAFLISEEASYINGQILAV
DGGFVNAGLALKGR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory