Comparing SMc00265 FitnessBrowser__Smeli:SMc00265 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4oanA Crystal structure of a trap periplasmic solute binding protein from rhodopseudomonas palustris haa2 (rpb_2686), target efi-510221, with density modeled as (s)-2-hydroxy-2-methyl-3-oxobutanoate ((s)-2- acetolactate) (see paper)
66% identity, 91% coverage: 28:332/336 of query aligns to 5:309/312 of 4oanA
P44542 Sialic acid-binding periplasmic protein SiaP; Extracytoplasmic solute receptor protein SiaP; N-acetylneuraminic-binding protein; Neu5Ac-binding protein from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 2 papers)
32% identity, 97% coverage: 3:329/336 of query aligns to 1:323/329 of P44542
2v4cA Structure of sialic acid binding protein (siap) in the presence of kdn (see paper)
33% identity, 83% coverage: 52:329/336 of query aligns to 25:300/309 of 2v4cA
2cexA Structure of a sialic acid binding protein (siap) in the presence of the sialic acid acid analogue neu5ac2en (see paper)
33% identity, 83% coverage: 52:329/336 of query aligns to 24:299/304 of 2cexA
Sites not aligning to the query:
3b50A Structure of h. Influenzae sialic acid binding protein bound to neu5ac. (see paper)
33% identity, 83% coverage: 52:329/336 of query aligns to 25:300/310 of 3b50A
Sites not aligning to the query:
2wx9A Crystal structure of the sialic acid binding periplasmic protein siap (see paper)
33% identity, 83% coverage: 52:329/336 of query aligns to 25:300/308 of 2wx9A
Sites not aligning to the query:
2cexB Structure of a sialic acid binding protein (siap) in the presence of the sialic acid acid analogue neu5ac2en (see paper)
33% identity, 83% coverage: 52:329/336 of query aligns to 24:299/305 of 2cexB
Sites not aligning to the query:
2xwoA Siap r147e mutant in complex with sialylamide (see paper)
33% identity, 83% coverage: 52:329/336 of query aligns to 25:300/308 of 2xwoA
Sites not aligning to the query:
4mmpA Structure of sialic acid binding protein from pasturella multocida (see paper)
34% identity, 83% coverage: 52:329/336 of query aligns to 26:301/308 of 4mmpA
Sites not aligning to the query:
4pddA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_0088, target efi-510167) bound to d- erythronate (see paper)
32% identity, 82% coverage: 52:328/336 of query aligns to 24:298/303 of 4pddA
Sites not aligning to the query:
4xeqB Crystal structure of a trap periplasmic solute binding protein from desulfovibrio vulgaris (deval_0042, target efi-510114) bound to copurified (r)-pantoic acid
33% identity, 76% coverage: 52:307/336 of query aligns to 24:278/304 of 4xeqB
Sites not aligning to the query:
4mnpA Structure of the sialic acid binding protein from fusobacterium nucleatum subsp. Nucleatum atcc 25586 (see paper)
33% identity, 82% coverage: 52:328/336 of query aligns to 24:301/305 of 4mnpA
7a5qB Crystal structure of vcsiap bound to sialic acid (see paper)
33% identity, 81% coverage: 49:320/336 of query aligns to 21:289/299 of 7a5qB
Sites not aligning to the query:
7a5qA Crystal structure of vcsiap bound to sialic acid (see paper)
33% identity, 81% coverage: 49:320/336 of query aligns to 21:289/299 of 7a5qA
Sites not aligning to the query:
4magA Crystal structure of the periplasmic sialic acid binding protein from vibrio cholerea (see paper)
33% identity, 81% coverage: 49:320/336 of query aligns to 21:289/307 of 4magA
Sites not aligning to the query:
7bbrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t (see paper)
30% identity, 87% coverage: 30:322/336 of query aligns to 10:298/310 of 7bbrA
7t3eA Structure of the sialic acid bound tripartite atp-independent periplasmic (trap) periplasmic component siap from photobacterium profundum (see paper)
33% identity, 82% coverage: 49:322/336 of query aligns to 22:292/300 of 7t3eA
Sites not aligning to the query:
7bcrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with galactonate (see paper)
30% identity, 87% coverage: 30:322/336 of query aligns to 9:297/310 of 7bcrA
7bcpA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with gluconate (see paper)
30% identity, 87% coverage: 30:322/336 of query aligns to 9:297/310 of 7bcpA
7bcoA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with d-foconate (see paper)
30% identity, 87% coverage: 30:322/336 of query aligns to 9:297/310 of 7bcoA
>SMc00265 FitnessBrowser__Smeli:SMc00265
MKMTRRTMLLGTGAVALGASIRTKAHAADFTYKLANNLPVTHPLNIRLKEAADKILEETG
GRLKINIFPSSQLGNDTETLSQLRNGATEFFSLSPLILSTLVPNAAISGIGFAFPDYDTV
WKAMDGELGAYARGEIEKKGLVPMEKIWDNGFRQITSSNKPINTPEDLKGFKIRVPPSPL
WQSMFTAFGAAPTTINFAEVYTALSTGTVDGQENPLAIASTAKLYEVQKHCAMTNHMWDG
FWMLANKQAWETLPEDIREIAAKHLNESAIAQRTDTAKVNDTVREQLTQSGMTFTDPDKA
AFRETLRSAGFYAEWKGKFGDEAWAILEKAVGTSLG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory