SitesBLAST
Comparing SMc00486 FitnessBrowser__Smeli:SMc00486 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P77454 Glutaminase 1; EC 3.5.1.2 from Escherichia coli (strain K12) (see 2 papers)
42% identity, 97% coverage: 10:313/315 of query aligns to 7:308/310 of P77454
- K69 (= K73) mutation to A: Loss of activity.
- N117 (= N120) mutation to A: Loss of activity.
- S160 (= S165) mutation to A: Loss of activity.
- E161 (= E166) mutation to A: Strongly reduced activity.
- Q162 (≠ T167) mutation to A: No effect.
- N168 (= N173) mutation to A: Loss of activity.
- Y192 (= Y197) mutation to A: Loss of activity.
- Y244 (= Y249) mutation to A: Loss of activity.
- S260 (= S265) mutation to A: Reduced activity.
- K294 (≠ L299) modified: N6-acetyllysine
5w2jB Crystal structure of dimeric form of mouse glutaminasE C (see paper)
37% identity, 90% coverage: 14:297/315 of query aligns to 96:379/411 of 5w2jB
Sites not aligning to the query:
D3Z7P3 Glutaminase kidney isoform, mitochondrial; GLS; EC 3.5.1.2 from Mus musculus (Mouse) (see 3 papers)
37% identity, 90% coverage: 14:297/315 of query aligns to 236:519/674 of D3Z7P3
- Y254 (= Y33) mutation to F: Increased enzyme activity in the absence of phosphate. No effect on stimulation of enzyme activity by phosphate.
- S291 (= S70) binding
- K316 (≠ R94) mutation to Q: Forms dimers with full, phosphate-independent activity; when associated with A-325 and K-391.
- G320 (= G98) mutation to P: Loss of enzyme activity.
- 320:327 (vs. 98:107, 30% identical) Highly mobile activation loop
- K325 (≠ S103) mutation to A: Constitutive enzyme activity that is fully active also in the absence phosphate. Forms oligomers with full, phosphate-independent activity; when associated with K-391. Forms dimers with full, phosphate-independent activity; when associated with Q-316 and K-391.
- N340 (= N120) binding
- E386 (= E166) binding
- D391 (≠ Y171) mutation to K: Abolishes assembly of dimers into functional tetramers. Loss of enzyme activity. Forms oligomers with full, phosphate-independent activity; when associated with A-325. Forms dimers with full, phosphate-independent activity; when associated with Q-316 and A-325.
- N393 (= N173) binding
- F394 (≠ I174) mutation to S: Impairs tetramerization and promotes formation of homodimers. Impairs activation by phosphate.
- Y419 (= Y197) binding
- Y471 (= Y249) binding
- V489 (= V267) binding
Sites not aligning to the query:
- 202 K→E: Increased stimulation of enzyme activity by phosphate.
- 207 K→E: Increased stimulation of enzyme activity by phosphate.
P13264 Glutaminase kidney isoform, mitochondrial; GLS; K-glutaminase; L-glutamine amidohydrolase; EC 3.5.1.2 from Rattus norvegicus (Rat) (see paper)
37% identity, 90% coverage: 14:297/315 of query aligns to 236:519/674 of P13264
Sites not aligning to the query:
6loxA Crystal structure of human glutaminase with macrocyclic inhibitor (see paper)
37% identity, 90% coverage: 14:297/315 of query aligns to 93:376/407 of 6loxA
- active site: S148 (= S70), K151 (= K73), Y276 (= Y197), Y328 (= Y249), V346 (= V267)
- binding (E)-15,22-Dioxa-4,11-diaza-5(2,5)-thiadiazola-10(3,6)-pyridazina-1,14(1,3)-dibenzenacyclodocosaphan-18-ene-3,12-dione: K182 (≠ S103), L183 (≠ I104), F184 (≠ L107), L185 (≠ E108), N186 (≠ H109), Y256 (≠ F179)
6umdB Crystal structure of human gac in complex with inhibitor upgl00012
37% identity, 90% coverage: 14:297/315 of query aligns to 95:378/409 of 6umdB
- active site: S150 (= S70), K153 (= K73), Y278 (= Y197), Y330 (= Y249), V348 (= V267)
- binding 2-(pyridin-3-yl)-N-(5-{4-[(5-{[(pyridin-3-yl)acetyl]amino}-1,3,4-thiadiazol-2-yl)amino]piperidin-1-yl}-1,3,4-thiadiazol-2-yl)acetamide: R181 (≠ A100), K184 (≠ S103), L185 (≠ I104), F186 (≠ L107), L187 (≠ E108), N188 (≠ H109), E189 (= E110), Y258 (≠ F179)
6ul9B Crystal structure of human gac in complex with inhibitor upgl00023
37% identity, 90% coverage: 14:297/315 of query aligns to 95:378/409 of 6ul9B
- active site: S150 (= S70), K153 (= K73), Y278 (= Y197), Y330 (= Y249), V348 (= V267)
- binding 2-phenyl-N-{5-[(1-{5-[(phenylacetyl)amino]-1,3,4-thiadiazol-2-yl}azetidin-3-yl)oxy]-1,3,4-thiadiazol-2-yl}acetamide: R181 (≠ A100), K184 (≠ S103), L185 (≠ I104), F186 (≠ L107), L187 (≠ E108), N188 (≠ H109), E189 (= E110), Y258 (≠ F179)
5fi7A Crystal structure of human gac in complex with inhibitor upgl_00015: 2-phenyl-~{n}-[5-[(3~{s})-3-[[5-(2-phenylethanoylamino)-1,3,4- thiadiazol-2-yl]oxy]pyrrolidin-1-yl]-1,3,4-thiadiazol-2-yl]ethanamide (see paper)
37% identity, 90% coverage: 14:297/315 of query aligns to 95:378/410 of 5fi7A
- active site: S150 (= S70), K153 (= K73), Y278 (= Y197), Y330 (= Y249), V348 (= V267)
- binding 2-phenyl-~{N}-[5-[(3~{S})-3-[[5-(2-phenylethanoylamino)-1,3,4-thiadiazol-2-yl]oxy]pyrrolidin-1-yl]-1,3,4-thiadiazol-2-yl]ethanamide: K184 (≠ S103), L185 (≠ I104), F186 (≠ L107), L187 (≠ E108), E189 (= E110), Y258 (≠ F179)
5fi6A Crystal structure of human gac in complex with inhibitor upgl_00011: 2-phenyl-~{n}-[5-[[(3~{s})-1-[5-(2-phenylethanoylamino)-1,3,4- thiadiazol-2-yl]pyrrolidin-3-yl]amino]-1,3,4-thiadiazol-2- yl]ethanamide (see paper)
37% identity, 90% coverage: 14:297/315 of query aligns to 95:378/410 of 5fi6A
- active site: S150 (= S70), K153 (= K73), Y278 (= Y197), Y330 (= Y249), V348 (= V267)
- binding 2-phenyl-~{N}-[5-[[(3~{S})-1-[5-(2-phenylethanoylamino)-1,3,4-thiadiazol-2-yl]pyrrolidin-3-yl]amino]-1,3,4-thiadiazol-2-yl]ethanamide: R181 (≠ A100), F182 (= F101), K184 (≠ S103), L185 (≠ I104), F186 (≠ L107), L187 (≠ E108), N188 (≠ H109), E189 (= E110), Y258 (≠ F179)
5fi2A Crystal structure of human gac in complex with inhibitor upgl_00009: 2-phenyl-~{n}-[5-[[(3~{r})-1-[5-(2-phenylethanoylamino)-1,3,4- thiadiazol- 2-yl]pyrrolidin-3-yl]amino]-1,3,4-thiadiazol-2- yl]ethanamide (see paper)
37% identity, 90% coverage: 14:297/315 of query aligns to 95:378/410 of 5fi2A
- active site: S150 (= S70), K153 (= K73), Y278 (= Y197), Y330 (= Y249), V348 (= V267)
- binding 2-phenyl-~{N}-[5-[[(3~{R})-1-[5-(2-phenylethanoylamino)-1,3,4-thiadiazol-2-yl]pyrrolidin-3-yl]amino]-1,3,4-thiadiazol-2-yl]ethanamide: K184 (≠ S103), L185 (≠ I104), F186 (≠ L107), L187 (≠ E108), Y258 (≠ F179)
8jueA Crystal structure of glutaminasE C in complex with compound 11 (see paper)
37% identity, 90% coverage: 14:297/315 of query aligns to 88:371/401 of 8jueA
6umfA Crystal structure of human gac in complex with inhibitor upgl00012
37% identity, 90% coverage: 14:297/315 of query aligns to 95:378/409 of 6umfA
- active site: S150 (= S70), K153 (= K73), Y278 (= Y197), Y330 (= Y249), V348 (= V267)
- binding N-(5-{[1-(5-amino-1,3,4-thiadiazol-2-yl)piperidin-4-yl]oxy}-1,3,4-thiadiazol-2-yl)-2-phenylacetamide: L185 (≠ I104), L187 (≠ E108), Y258 (≠ F179)
6uljA Crystal structure of human gac in complex with inhibitor upgl00012
37% identity, 90% coverage: 14:297/315 of query aligns to 95:378/409 of 6uljA
6ulaA Crystal structure of human gac in complex with inhibitor upgl00012
37% identity, 90% coverage: 14:297/315 of query aligns to 95:378/409 of 6ulaA
- active site: S150 (= S70), K153 (= K73), Y278 (= Y197), Y330 (= Y249), V348 (= V267)
- binding 2-cyclopropyl-N-{5-[4-({5-[(cyclopropylacetyl)amino]-1,3,4-thiadiazol-2-yl}oxy)piperidin-1-yl]-1,3,4-thiadiazol-2-yl}acetamide: K184 (≠ S103), L185 (≠ I104), F186 (≠ L107), L187 (≠ E108), N188 (≠ H109), Y258 (≠ F179)
6ukbA Crystal structure of human gac in complex with inhibitor upgl00012
37% identity, 90% coverage: 14:297/315 of query aligns to 95:378/409 of 6ukbA
- active site: S150 (= S70), K153 (= K73), Y278 (= Y197), Y330 (= Y249), V348 (= V267)
- binding N-[5-(4-{[5-(acetylamino)-1,3,4-thiadiazol-2-yl]oxy}piperidin-1-yl)-1,3,4-thiadiazol-2-yl]acetamide: K184 (≠ S103), L185 (≠ I104), F186 (≠ L107), L187 (≠ E108), Y258 (≠ F179)
6ujmA Crystal structure of human gac in complex with inhibitor upgl00013
37% identity, 90% coverage: 14:297/315 of query aligns to 95:378/409 of 6ujmA
- active site: S150 (= S70), K153 (= K73), Y278 (= Y197), Y330 (= Y249), V348 (= V267)
- binding N-{5-[(3R)-3-{[5-(acetylamino)-1,3,4-thiadiazol-2-yl]amino}pyrrolidin-1-yl]-1,3,4-thiadiazol-2-yl}acetamide: K184 (≠ S103), L185 (≠ I104), F186 (≠ L107), L187 (≠ E108), Y258 (≠ F179)
8jubA Crystal structure of glutaminasE C in complex with compound 27 (see paper)
37% identity, 90% coverage: 14:297/315 of query aligns to 87:370/401 of 8jubA
6umcB Crystal structure of human gac in complex with inhibitor upgl00012
37% identity, 90% coverage: 14:297/315 of query aligns to 95:378/410 of 6umcB
- active site: S150 (= S70), K153 (= K73), Y278 (= Y197), Y330 (= Y249), V348 (= V267)
- binding 2-phenyl-N-{5-[(3R)-3-({5-[(phenylacetyl)amino]-1,3,4-thiadiazol-2-yl}oxy)pyrrolidin-1-yl]-1,3,4-thiadiazol-2-yl}acetamide: K184 (≠ S103), L185 (≠ I104), F186 (≠ L107), L187 (≠ E108), E189 (= E110), Y258 (≠ F179)
6ujgA Crystal structure of human gac in complex with inhibitor upgl00012
37% identity, 90% coverage: 14:297/315 of query aligns to 95:378/410 of 6ujgA
- active site: S150 (= S70), K153 (= K73), Y278 (= Y197), Y330 (= Y249), V348 (= V267)
- binding N-{5-[(3S)-3-{[5-(acetylamino)-1,3,4-thiadiazol-2-yl]amino}pyrrolidin-1-yl]-1,3,4-thiadiazol-2-yl}acetamide: K184 (≠ S103), L185 (≠ I104), F186 (≠ L107), L187 (≠ E108), Y258 (≠ F179)
5wj6A Crystal structure of glutaminasE C in complex with inhibitor 2-phenyl- n-{5-[4-({5-[(phenylacetyl)amino]-1,3,4-thiadiazol-2-yl}amino) piperidin-1-yl]-1,3,4-thiadiazol-2-yl}acetamide (upgl-00004) (see paper)
37% identity, 90% coverage: 14:297/315 of query aligns to 95:378/410 of 5wj6A
- active site: S150 (= S70), K153 (= K73), Y278 (= Y197), Y330 (= Y249), V348 (= V267)
- binding 2-phenyl-N-{5-[4-({5-[(phenylacetyl)amino]-1,3,4-thiadiazol-2-yl}amino)piperidin-1-yl]-1,3,4-thiadiazol-2-yl}acetamide: R181 (≠ A100), K184 (≠ S103), L185 (≠ I104), F186 (≠ L107), L187 (≠ E108), N188 (≠ H109), E189 (= E110), Y258 (≠ F179)
Query Sequence
>SMc00486 FitnessBrowser__Smeli:SMc00486
MREPKPQEDLQAIIDDIYRELTPRLGEGKVADYIPQLARVDARHFGMAIVTTGGEVYRVG
DAEMPFSIQSISKVFTLTLALGKHGENIWNRVGREPSGSAFNSIVQLEHEGGKPRNPFIN
AGAIRISDLILAGHTPKELIGEIVRFVRYLADDENIVIDHEVARSETATGYRNIALANFM
RSFGRLDHPVEHVLGVYFHHCALAMTCSQLAKAGLFLAAGGTNPLTGHSVVSRQRARRIN
ALMLTCGHYDGSGDFAYRVGLPGKSGVGGGIMAVAPGKASIAVWSPGLNDYGNSLLGSLA
LEMLAARTGWSVFGP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory