SitesBLAST
Comparing SMc00675 FitnessBrowser__Smeli:SMc00675 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6torB Human o-phosphoethanolamine phospho-lyase (see paper)
42% identity, 41% coverage: 573:971/975 of query aligns to 2:394/404 of 6torB
5g4jA Phospholyase a1rdf1 from arthrobacter in complex with phosphoethanolamine (see paper)
35% identity, 43% coverage: 552:967/975 of query aligns to 2:414/423 of 5g4jA
- active site: S14 (≠ Q564), Y130 (= Y680), D201 (≠ E754), D234 (= D787), Q237 (= Q790), K264 (= K817), T294 (≠ S847), K395 (= K948)
- binding {5-hydroxy-6-methyl-4-[(E)-{[2-(phosphonooxy)ethyl]imino}methyl]pyridin-3-yl}methyl dihydrogen phosphate: Y44 (≠ V594), R73 (= R623), G103 (= G653), S104 (= S654), Y130 (= Y680), H131 (= H681), D234 (= D787), V236 (= V789), Q237 (= Q790), K264 (= K817), T294 (≠ S847), R397 (≠ K950)
5g4iA Plp-dependent phospholyase a1rdf1 from arthrobacter aurescens tc1 (see paper)
35% identity, 43% coverage: 552:967/975 of query aligns to 2:414/423 of 5g4iA
- active site: S14 (≠ Q564), Y130 (= Y680), D201 (≠ E754), D234 (= D787), Q237 (= Q790), K264 (= K817), T294 (≠ S847), K395 (= K948)
- binding pyridoxal-5'-phosphate: G103 (= G653), S104 (= S654), H131 (= H681), D234 (= D787), V236 (= V789), Q237 (= Q790), K264 (= K817)
- binding phosphate ion: Y44 (≠ V594), R397 (≠ K950)
1zobA Crystal structure of dialkylglycine decarboxylases bound with calcium ion
32% identity, 44% coverage: 546:972/975 of query aligns to 1:428/431 of 1zobA
- active site: G19 (≠ Q564), W136 (≠ Y680), E208 (= E754), D241 (= D787), Q244 (= Q790), K270 (= K817), T301 (≠ S847), R404 (≠ K948)
- binding calcium ion: L76 (≠ T620), S78 (= S622), V303 (≠ G849), S304 (≠ G850), D305 (≠ S851)
- binding pyridoxal-5'-phosphate: T108 (≠ S652), A110 (≠ S654), N113 (= N657), W136 (≠ Y680), H137 (= H681), E208 (= E754), D241 (= D787), A243 (≠ V789), Q244 (= Q790), K270 (= K817)
1zc9A The crystal structure of dialkylglycine decarboxylase complex with pyridoxamine 5-phosphate (see paper)
32% identity, 44% coverage: 546:972/975 of query aligns to 1:428/431 of 1zc9A
- active site: G19 (≠ Q564), W136 (≠ Y680), E208 (= E754), D241 (= D787), Q244 (= Q790), K270 (= K817), T301 (≠ S847), R404 (≠ K948)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G109 (= G653), A110 (≠ S654), W136 (≠ Y680), H137 (= H681), E208 (= E754), D241 (= D787), A243 (≠ V789), Q244 (= Q790), K270 (= K817)
1m0qA Structure of dialkylglycine decarboxylase complexed with s-1- aminoethanephosphonate (see paper)
32% identity, 44% coverage: 546:972/975 of query aligns to 1:428/431 of 1m0qA
- active site: G19 (≠ Q564), W136 (≠ Y680), E208 (= E754), D241 (= D787), Q244 (= Q790), K270 (= K817), T301 (≠ S847), R404 (≠ K948)
- binding (1s)-1-[((1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylene)amino]ethylphosphonic acid: Q50 (vs. gap), T108 (≠ S652), A110 (≠ S654), W136 (≠ Y680), H137 (= H681), E208 (= E754), S213 (≠ N759), D241 (= D787), A243 (≠ V789), Q244 (= Q790), K270 (= K817), R404 (≠ K948)
1m0pA Structure of dialkylglycine decarboxylase complexed with 1-amino-1- phenylethanephosphonate (see paper)
32% identity, 44% coverage: 546:972/975 of query aligns to 1:428/431 of 1m0pA
- active site: G19 (≠ Q564), W136 (≠ Y680), E208 (= E754), D241 (= D787), Q244 (= Q790), K270 (= K817), T301 (≠ S847), R404 (≠ K948)
- binding (1r)-1-[((1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylene)amino]-1-phenylethylphosphonic acid: Q50 (vs. gap), T108 (≠ S652), A110 (≠ S654), W136 (≠ Y680), H137 (= H681), E208 (= E754), S213 (≠ N759), D241 (= D787), A243 (≠ V789), Q244 (= Q790), K270 (= K817), R404 (≠ K948)
1m0oA Structure of dialkylglycine decarboxylase complexed with 1-amino-1- methylpropanephosphonate (see paper)
32% identity, 44% coverage: 546:972/975 of query aligns to 1:428/431 of 1m0oA
- active site: G19 (≠ Q564), W136 (≠ Y680), E208 (= E754), D241 (= D787), Q244 (= Q790), K270 (= K817), T301 (≠ S847), R404 (≠ K948)
- binding (1r)-1-[((1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylene)amino]-1-methylpropylphosphonic acid: Q50 (vs. gap), G109 (= G653), A110 (≠ S654), W136 (≠ Y680), H137 (= H681), E208 (= E754), D241 (= D787), Q244 (= Q790), K270 (= K817), R404 (≠ K948)
1m0nA Structure of dialkylglycine decarboxylase complexed with 1- aminocyclopentanephosphonate (see paper)
32% identity, 44% coverage: 546:972/975 of query aligns to 1:428/431 of 1m0nA
- active site: G19 (≠ Q564), W136 (≠ Y680), E208 (= E754), D241 (= D787), Q244 (= Q790), K270 (= K817), T301 (≠ S847), R404 (≠ K948)
- binding 1-[((1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylene)amino]cyclopentylphosphonic acid: Q50 (vs. gap), M51 (vs. gap), A110 (≠ S654), N113 (= N657), W136 (≠ Y680), H137 (= H681), E208 (= E754), S213 (≠ N759), D241 (= D787), A243 (≠ V789), Q244 (= Q790), K270 (= K817), R404 (≠ K948)
1d7vA Crystal structure of the complex of 2,2-dialkylglycine decarboxylase with nma (see paper)
32% identity, 44% coverage: 546:972/975 of query aligns to 1:428/431 of 1d7vA
- active site: G19 (≠ Q564), W136 (≠ Y680), E208 (= E754), D241 (= D787), Q244 (= Q790), K270 (= K817), T301 (≠ S847), R404 (≠ K948)
- binding potassium ion: H75 (vs. gap), L76 (≠ T620), F77 (≠ N621), S78 (= S622), T301 (≠ S847), H302 (≠ A848), V303 (≠ G849), S304 (≠ G850), D305 (≠ S851)
- binding n-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-2-methylalanine: A110 (≠ S654), W136 (≠ Y680), H137 (= H681), E208 (= E754), S213 (≠ N759), D241 (= D787), A243 (≠ V789), Q244 (= Q790), K270 (= K817), R404 (≠ K948)
1d7uA Crystal structure of the complex of 2,2-dialkylglycine decarboxylase with lcs (see paper)
32% identity, 44% coverage: 546:972/975 of query aligns to 1:428/431 of 1d7uA
- active site: G19 (≠ Q564), W136 (≠ Y680), E208 (= E754), D241 (= D787), Q244 (= Q790), K270 (= K817), T301 (≠ S847), R404 (≠ K948)
- binding potassium ion: H75 (vs. gap), L76 (≠ T620), F77 (≠ N621), S78 (= S622), T301 (≠ S847), H302 (≠ A848), V303 (≠ G849), S304 (≠ G850), D305 (≠ S851)
- binding [5-hydroxy-6-methyl-4-({[(4E)-3-oxo-1,2-oxazolidin-4-ylidene]amino}methyl)pyridin-3-yl]methyl dihydrogen phosphate: G109 (= G653), A110 (≠ S654), W136 (≠ Y680), H137 (= H681), E208 (= E754), D241 (= D787), A243 (≠ V789), Q244 (= Q790), K270 (= K817), R404 (≠ K948)
1d7sA Crystal structure of the complex of 2,2-dialkylglycine decarboxylase with dcs (see paper)
32% identity, 44% coverage: 546:972/975 of query aligns to 1:428/431 of 1d7sA
- active site: G19 (≠ Q564), W136 (≠ Y680), E208 (= E754), D241 (= D787), Q244 (= Q790), K270 (= K817), T301 (≠ S847), R404 (≠ K948)
- binding d-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-n,o-cycloserylamide: Q50 (vs. gap), G109 (= G653), A110 (≠ S654), W136 (≠ Y680), H137 (= H681), E208 (= E754), D241 (= D787), A243 (≠ V789), Q244 (= Q790), K270 (= K817), R404 (≠ K948)
- binding potassium ion: H75 (vs. gap), L76 (≠ T620), F77 (≠ N621), S78 (= S622), T301 (≠ S847), H302 (≠ A848), V303 (≠ G849), S304 (≠ G850), D305 (≠ S851)
1d7rA Crystal structure of the complex of 2,2-dialkylglycine decarboxylase with 5pa (see paper)
32% identity, 44% coverage: 546:972/975 of query aligns to 1:428/431 of 1d7rA
- active site: G19 (≠ Q564), W136 (≠ Y680), E208 (= E754), D241 (= D787), Q244 (= Q790), K270 (= K817), T301 (≠ S847), R404 (≠ K948)
- binding n-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-y-lmethyl]-1-amino-cyclopropanecarboxylic acid: G109 (= G653), A110 (≠ S654), W136 (≠ Y680), H137 (= H681), E208 (= E754), S213 (≠ N759), D241 (= D787), A243 (≠ V789), Q244 (= Q790), K270 (= K817), R404 (≠ K948)
- binding potassium ion: H75 (vs. gap), L76 (≠ T620), F77 (≠ N621), S78 (= S622), T301 (≠ S847), H302 (≠ A848), V303 (≠ G849), S304 (≠ G850), D305 (≠ S851)
1dgdA An alkali metal ion size-dependent switch in the active site structure of dialkylglycine decarboxylase (see paper)
32% identity, 44% coverage: 546:972/975 of query aligns to 1:428/431 of 1dgdA
- active site: G19 (≠ Q564), W136 (≠ Y680), E208 (= E754), D241 (= D787), Q244 (= Q790), K270 (= K817), T301 (≠ S847), R404 (≠ K948)
- binding pyridoxal-5'-phosphate: T108 (≠ S652), G109 (= G653), A110 (≠ S654), W136 (≠ Y680), H137 (= H681), E208 (= E754), D241 (= D787), A243 (≠ V789), Q244 (= Q790), K270 (= K817)
5wyaA Structure of amino acid racemase, 2.65 a (see paper)
31% identity, 43% coverage: 546:961/975 of query aligns to 2:419/439 of 5wyaA
- active site: A20 (≠ Q564), Y140 (= Y680), E215 (= E754), D248 (= D787), N251 (≠ Q790), K278 (= K817), T307 (≠ S846), R406 (≠ K948)
- binding (2S,3S)-3-methyl-2-[[2-methyl-3-oxidanyl-5-(phosphonooxymethyl)pyridin-4-yl]methylamino]pentanoic acid: A52 (≠ V597), Y82 (≠ R623), S112 (= S652), G113 (= G653), S114 (= S654), Y140 (= Y680), H141 (= H681), E215 (= E754), D248 (= D787), V250 (= V789), N251 (≠ Q790), K278 (= K817), F306 (= F845), T307 (≠ S846), R406 (≠ K948)
4ysnC Structure of aminoacid racemase in complex with plp (see paper)
31% identity, 43% coverage: 546:961/975 of query aligns to 11:428/448 of 4ysnC
- active site: A29 (≠ Q564), Y149 (= Y680), E224 (= E754), D257 (= D787), N260 (≠ Q790), K287 (= K817), T316 (≠ S846), R415 (≠ K948)
- binding pyridoxal-5'-phosphate: S121 (= S652), G122 (= G653), S123 (= S654), Y149 (= Y680), H150 (= H681), E224 (= E754), D257 (= D787), V259 (= V789), K287 (= K817), F315 (= F845), T316 (≠ S846)
5wyfA Structure of amino acid racemase, 2.12 a (see paper)
31% identity, 43% coverage: 546:961/975 of query aligns to 4:421/446 of 5wyfA
- active site: A22 (≠ Q564), Y142 (= Y680), E217 (= E754), D250 (= D787), N253 (≠ Q790), K280 (= K817), T309 (≠ S846), R408 (≠ K948)
- binding n-[o-phosphono-pyridoxyl]-isoleucine: A54 (≠ V597), Y84 (≠ R623), G115 (= G653), S116 (= S654), Y142 (= Y680), H143 (= H681), D222 (≠ N759), D250 (= D787), V252 (= V789), N253 (≠ Q790), K280 (= K817), F308 (= F845), T309 (≠ S846), R408 (≠ K948)
7vo1A Structure of aminotransferase-substrate complex (see paper)
29% identity, 43% coverage: 547:967/975 of query aligns to 11:436/452 of 7vo1A
- binding N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-L-glutamic acid: I61 (≠ V597), S121 (= S652), G122 (= G653), T123 (≠ S654), F149 (≠ Y680), H150 (= H681), R152 (≠ W683), E234 (≠ N759), D262 (= D787), V264 (= V789), Q265 (= Q790), K291 (= K817), N318 (≠ S846), T319 (≠ S847), R417 (≠ K948)
7vntA Structure of aminotransferase-substrate complex (see paper)
29% identity, 43% coverage: 547:967/975 of query aligns to 11:436/452 of 7vntA
- binding L-ornithine: F149 (≠ Y680), R152 (≠ W683), E234 (≠ N759), K291 (= K817)
- binding pyridoxal-5'-phosphate: G122 (= G653), T123 (≠ S654), F149 (≠ Y680), H150 (= H681), E229 (= E754), D262 (= D787), V264 (= V789), Q265 (= Q790), K291 (= K817)
7vnoA Structure of aminotransferase (see paper)
29% identity, 43% coverage: 547:967/975 of query aligns to 11:436/452 of 7vnoA
Query Sequence
>SMc00675 FitnessBrowser__Smeli:SMc00675
MEDELLKRRTQLARPDVSIEEAQAILAQHYGLSGDLTELGSQQDRNYRVDTSEGPFVLKI
ARAEYARVEIEAQNAALRHVATRPDAPKVPEVVSALSGEEIVTAAVREETYQFRLLTYLD
GTPLTRRRHLAVETVAALGDVAGRLAVALRDFDHPGLERELQWDLRRAGPVALHLLSAMS
DVDLRKRIAEAMVGAMRRVQPLMPDLRLQAIHQDVTDDNVVSRADRSGRLIPDGVIDFGD
VLKGWVVADLAVTCASLLHHAGGDPFQILPAVKAFHAVCPLTDAELKALWPLIVARACVL
VASTAQQLEVDPENAYVEGNAAHEREIFDVAVSVPLDLMEHAIGEAVERSPQLSPPGMGR
RLLPELDPSEIGIVDLSSLGPHLPADRWHYEDTEALLLQSAARAAGAAATRYGEYRLTET
RLLQASAPRTFALHVDLCLHGQTAVHAPFAGRLHQRGGKLIFSGEGLHLHLYGVEAADLA
EEAFEAGARIGVVPGDPSALGFMRVQLCTTPELHPPAFAASHQAGAWCRLCPSPSPILGF
DCDAALPDAAGLLERRRRHYARPQKNYYRTPPQIERGWKEHLFDVEGRAYLDMVNNVTLV
GHGHPRLSAAVGRQWSLLNTNSRFHYAAVTEFSERLAALAPEGLDTVFLVNSGSEANDLA
IRLAWAHSGARNMISLLEAYHGWTVASDAVSTSIADNPQALTTRPDWVHPVVSPNTYRGP
FRGEDSTVGYVDAVSRKLADLDEKGGKLAGFISEPVYGNAGGIPLPSGYLEAVYAMVRER
SGVCIADEVQVGYGRLGHHFWGFEQQGVVPDIITVAKGMGNGHPLGAVITRREIADALEK
EGYFFSSAGGSPVSSVVGLTVLDILHDDALQENARAVGTHLKSRLEALGDRFPLVGAVHG
MGLYLGVEFVRDRETLEPATEETAAICDRLLDLGIVMQPTGDHLNVLKIKPPLCLARESA
DFFADMLGRVLEEGW
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory